BSND (NM_057176) Human Tagged ORF Clone

CAT#: RC213125

Reviews ()
Write a review

BSND (Myc-DDK-tagged)-Human Bartter syndrome, infantile, with sensorineural deafness (Barttin) (BSND)



  "NM_057176" in other vectors (4)

USD 420.00


Availability*
In Stock

Size
    • 10 ug


Product images

Specifications

Product Data
Product Name BSND (NM_057176) Human Tagged ORF Clone
Type Human Tagged ORF Clone
Tag Myc-DDK
Symbol BSND
Synonyms BART; DFNB73
Vector pCMV6-Entry
E. coli Selection Kanamycin (25 ug/mL)
Cell Selection Neomycin
Sequence Data
>RC213125 ORF sequence
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGGCTGACGAGAAGACCTTCCGGATCGGCTTCATTGTGCTGGGGCTTTTCCTGCTGGCCCTCGGTACGT
TCCTCATGAGCCATGATCGGCCCCAGGTCTACGGCACCTTCTATGCCATGGGCAGCGTCATGGTGATCGG
GGGCATCATCTGGAGCATGTGCCAGTGCTACCCCAAGATCACCTTCGTCCCTGCTGACTCTGACTTTCAA
GGCATCCTCTCCCCAAAGGCCATGGGCCTGCTGGAGAATGGGCTTGCTGCCGAGATGAAGAGCCCCAGTC
CCCAGCCGCCCTATGTAAGGCTGTGGGAGGAAGCCGCCTATGACCAGAGCCTGCCTGACTTCAGCCACAT
CCAGATGAAAGTCATGAGCTACAGTGAGGACCACCGCTCCTTGCTGGCCCCTGAGATGGGGCAGCCGAAG
CTGGGAACCAGTGATGGAGGAGAAGGTGGCCCTGGCGACGTTCAGGCCTGGATGGAGGCTGCCGTGGTCA
TCCACAAGGGCTCAGACGAGAGTGAAGGGGAAAGACGCCTAACTCAGAGCTGGCCCGGCCCCCTGGCCTG
TCCCCAGGGCCCTGCCCCCTTGGCTTCCTTCCAAGATGACCTGGACATGGACTCCAGTGAAGGCAGCAGC
CCCAATGCATCTCCACATGACAGGGAGGAAGCTTGTTCCCCACAACAGGAACCTCAGGGCTGCAGGTGCC
CGCTGGACCGCTTCCAAGACTTTGCCCTGATTGATGCCCCAACGTTGGAGGATGAGCCCCAAGAGGGGCA
GCAGTGGGAAATAGCCCTGCCCAACAACTGGCAGCGGTACCCAAGGACAAAGGTGGAGGAGAAGGAGGCT
TCGGACACAGGTGGGGAGGAACCTGAGAAGGAAGAGGAAGACCTGTACTATGGGCTGCCAGATGGAGCCG
GGGACCTCCTCCCGGACAAGGAGCTGGGTTTTGAGCCTGACACCCAAGGC


ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT
ACAAGGATGACGACGATAAG
GTTTAA
>RC213125 protein sequence
Red=Cloning site Green=Tags(s)

MADEKTFRIGFIVLGLFLLALGTFLMSHDRPQVYGTFYAMGSVMVIGGIIWSMCQCYPKITFVPADSDFQ
GILSPKAMGLLENGLAAEMKSPSPQPPYVRLWEEAAYDQSLPDFSHIQMKVMSYSEDHRSLLAPEMGQPK
LGTSDGGEGGPGDVQAWMEAAVVIHKGSDESEGERRLTQSWPGPLACPQGPAPLASFQDDLDMDSSEGSS
PNASPHDREEACSPQQEPQGCRCPLDRFQDFALIDAPTLEDEPQEGQQWEIALPNNWQRYPRTKVEEKEA
SDTGGEEPEKEEEDLYYGLPDGAGDLLPDKELGFEPDTQG

myc-FLAG tag
Chromatograms CHROMATOGRAMS
Sequencher program is needed, download here.
Restriction Sites SgfI-MluI      Cloning Scheme for this gene      Plasmid Map     
Tag Myc-DDK
ACCN NM_057176
ORF Size 960 bp
OTI Disclaimer The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Product Components The ORF clone is ion-exchange column purified, transfection-ready dried plasmid DNA, and shipped with 2 vector sequencing primers.
Reconstitution 1. Centrifuge at 5,000xg for 5min.
2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA.
3. Close the tube and incubate for 10 minutes at room temperature.
4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom.
5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C.
Reference Data
RefSeq NM_057176.1, NM_057176.2, NP_476517.1
RefSeq Size 1396 bp
RefSeq ORF 963 bp
Locus ID 7809
Cytogenetics 1p32.3
Protein Families Druggable Genome, Transmembrane
MW 35.2 kDa
Gene Summary This gene encodes an essential beta subunit for CLC chloride channels. These heteromeric channels localize to basolateral membranes of renal tubules and of potassium-secreting epithelia of the inner ear. Mutations in this gene have been associated with Bartter syndrome with sensorineural deafness. [provided by RefSeq, Jul 2008]

Citations (1)

Other Versions

Other products for "BSND"
Frequently bought together (3)
Clone OTI4C5, Anti-DDK (FLAG) monoclonal antibody
    • 100 ul

USD 310.00


pCMV6-Entry, mammalian vector with C-terminal Myc- DDK Tag, 10ug
    • 10 ug

USD 570.00


Rabbit Polyclonal Anti-BSND Antibody
    • 100 ul

USD 375.00

Customer Reviews 
Loading...
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.
68 Mouse Clones
Molbio tools