CXCR5 (NM_001716) Human Tagged ORF Clone

CAT#: RC213050

CXCR5 (Myc-DDK-tagged)-Human chemokine (C-X-C motif) receptor 5 (CXCR5), transcript variant 1

Change vector?

USD 577


Availability*
In Stock

Size
    • 10 ug

Product images

Specifications

Product Data
Product Name CXCR5 (NM_001716) Human Tagged ORF Clone
Symbol CXCR5
Synonyms BLR1; CD185; MDR15
Vector pCMV6-Entry
Sequence Data
ORF Nucleotide Sequence
>RC213050 representing NM_001716
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGAACTACCCGCTAACGCTGGAAATGGACCTCGAGAACCTGGAGGACCTGTTCTGGGAACTGGACAGAT
TGGACAACTATAACGACACCTCCCTGGTGGAAAATCATCTCTGCCCTGCCACAGAGGGGCCCCTCATGGC
CTCCTTCAAGGCCGTGTTCGTGCCCGTGGCCTACAGCCTCATCTTCCTCCTGGGCGTGATCGGCAACGTC
CTGGTGCTGGTGATCCTGGAGCGGCACCGGCAGACACGCAGTTCCACGGAGACCTTCCTGTTCCACCTGG
CCGTGGCCGACCTCCTGCTGGTCTTCATCTTGCCCTTTGCCGTGGCCGAGGGCTCTGTGGGCTGGGTCCT
GGGGACCTTCCTCTGCAAAACTGTGATTGCCCTGCACAAAGTCAACTTCTACTGCAGCAGCCTGCTCCTG
GCCTGCATCGCCGTGGACCGCTACCTGGCCATTGTCCACGCCGTCCATGCCTACCGCCACCGCCGCCTCC
TCTCCATCCACATCACCTGTGGGACCATCTGGCTGGTGGGCTTCCTCCTTGCCTTGCCAGAGATTCTCTT
CGCCAAAGTCAGCCAAGGCCATCACAACAACTCCCTGCCACGTTGCACCTTCTCCCAAGAGAACCAAGCA
GAAACGCATGCCTGGTTCACCTCCCGATTCCTCTACCATGTGGCGGGATTCCTGCTGCCCATGCTGGTGA
TGGGCTGGTGCTACGTGGGGGTAGTGCACAGGTTGCGCCAGGCCCAGCGGCGCCCTCAGCGGCAGAAGGC
AGTCAGGGTGGCCATCCTGGTGACAAGCATCTTCTTCCTCTGCTGGTCACCCTACCACATCGTCATCTTC
CTGGACACCCTGGCGAGGCTGAAGGCCGTGGACAATACCTGCAAGCTGAATGGCTCTCTCCCCGTGGCCA
TCACCATGTGTGAGTTCCTGGGCCTGGCCCACTGCTGCCTCAACCCCATGCTCTACACTTTCGCCGGCGT
GAAGTTCCGCAGTGACCTGTCGCGGCTCCTGACGAAGCTGGGCTGTACCGGCCCTGCCTCCCTGTGCCAG
CTCTTCCCTAGCTGGCGCAGGAGCAGTCTCTCTGAGTCAGAGAATGCCACCTCTCTCACCACGTTC


ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT
ACAAGGATGACGACGATAAG
GTTTAA
Protein Sequence
>RC213050 representing NM_001716
Red=Cloning site Green=Tags(s)

MNYPLTLEMDLENLEDLFWELDRLDNYNDTSLVENHLCPATEGPLMASFKAVFVPVAYSLIFLLGVIGNV
LVLVILERHRQTRSSTETFLFHLAVADLLLVFILPFAVAEGSVGWVLGTFLCKTVIALHKVNFYCSSLLL
ACIAVDRYLAIVHAVHAYRHRRLLSIHITCGTIWLVGFLLALPEILFAKVSQGHHNNSLPRCTFSQENQA
ETHAWFTSRFLYHVAGFLLPMLVMGWCYVGVVHRLRQAQRRPQRQKAVRVAILVTSIFFLCWSPYHIVIF
LDTLARLKAVDNTCKLNGSLPVAITMCEFLGLAHCCLNPMLYTFAGVKFRSDLSRLLTKLGCTGPASLCQ
LFPSWRRSSLSESENATSLTTF

myc-FLAG tag
Chromatograms CHROMATOGRAMS
Sequencher program is needed, download here.
Restriction Sites SgfI-MluI      Cloning Scheme for this gene      Plasmid Map     
Tag Myc-DDK
ACCN NM_001716
ORF Size 1116 bp
OTI Disclaimer Due to the inherent nature of this plasmid, standard methods to replicate additional amounts of DNA in E. coli are highly likely to result in mutations and/or rearrangements. Therefore, OriGene does not guarantee the capability to replicate this plasmid DNA. Additional amounts of DNA can be purchased from OriGene with batch-specific, full-sequence verification at a reduced cost. Please contact our customer care team at custsupport@origene.com or by calling 301.340.3188 option 3 for pricing and delivery.

The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Product Components The ORF clone is ion-exchange column purified, transfection-ready dried plasmid DNA, and shipped with 2 vector sequencing primers.
Reference Data
RefSeq NM_001716.1, NM_001716.2, NM_001716.3, NM_001716.4, NP_001707
RefSeq Size 2824
RefSeq ORF 1119
Locus ID 643
Cytogenetics 11q23.3
Domains 7tm_1
Protein Families GPCR, Transmembrane, Druggable Genome
Protein Pathways Cytokine-cytokine receptor interaction, Chemokine signaling pathway
MW 41.8 kDa
Gene Summary This gene encodes a multi-pass membrane protein that belongs to the CXC chemokine receptor family. It is expressed in mature B-cells and Burkitt's lymphoma. This cytokine receptor binds to B-lymphocyte chemoattractant (BLC), and is involved in B-cell migration into B-cell follicles of spleen and Peyer patches. Alternatively spliced transcript variants encoding different isoforms have been described for this gene. [provided by RefSeq, Aug 2011].
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Citations