Macrophage inflammatory protein 5 (CCL15) (NM_032965) Human Tagged ORF Clone

CAT#: RC213037

CCL15 (Myc-DDK-tagged)-Human chemokine (C-C motif) ligand 15 (CCL15)

Product Images

Circular map for RC213037

• 

  Western blot validation of overexpression lysate (Cat# LY418174) using anti-DDK antibody (Cat# TA50011-100). Left: Cell lysates from un-transfected HEK293T cells; Right: Cell lysates from HEK293T cells transfected with RC219289 using transfection reagent MegaTran 2.0 (Cat# TT210002).

Specifications

Product Data

• Type: Human Tagged ORF Clone
• Tag: Myc-DDK
• Symbol: Macrophage inflammatory protein 5
• Synonyms: HCC-2; HMRP-2B; LKN-1; LKN1; MIP-1 delta; MIP-1D; MIP-5; MRP-2B; NCC-3; NCC3; SCYA15; SCYL3; SY15
• Vector: pCMV6-Entry
• E. coli Selection: Kanamycin (25 ug/mL)
• Mammalian Cell Selection: Neomycin
• Sequence Data:
  ORF Nucleotide Sequence

  >RC213037 representing NM_032965
  Red=Cloning site Blue=ORF Green=Tags(s)
  
  TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
  GCCGCGATCGCC
  
  ATGAAGGTCTCCGTGGCTGCCCTCTCCTGCCTCATGCTTGTTGCTGTCCTTGGATCCCAGGCCCAGTTCA
  CAAATGATGCAGAGACAGAGTTAATGATGTCAAAGCTTCCACTGGAAAATCCAGTAGTTCTGAACAGCTT
  TCACTTTGCTGCTGACTGCTGCACCTCCTACATCTCACAAAGCATCCCGTGTTCACTCATGAAAAGTTAT
  TTTGAAACGAGCAGCGAGTGCTCCAAGCCAGGTGTCATATTCCTCACCAAGAAGGGGCGGCAAGTCTGTG
  CCAAACCCAGTGGTCCGGGAGTTCAGGATTGCATGAAAAAGCTGAAGCCCTACTCAATA
  
  ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT
  ACAAGGATGACGACGATAAGGTTTAA
  Protein Sequence

  >RC213037 representing NM_032965
  Red=Cloning site Green=Tags(s)
  
  MKVSVAALSCLMLVAVLGSQAQFTNDAETELMMSKLPLENPVVLNSFHFAADCCTSYISQSIPCSLMKSY
  FETSSECSKPGVIFLTKKGRQVCAKPSGPGVQDCMKKLKPYSI
  
  myc-FLAG tag
• Restriction Sites: SgfI-MluI Cloning Scheme for this gene Plasmid Map
• ACCN: NM_032965
• ORF Size: 339 bp
• OTI Disclaimer: The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
• OTI Annotation: This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
• Product Components: The ORF clone is ion-exchange column purified and shipped in a 2D barcoded Matrix tube containing 10ug of transfection-ready, dried plasmid DNA (reconstitute with 100 ul of water).
• Reconstitution: 1. Centrifuge at 5,000xg for 5min.
  2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA.
  3. Close the tube and incubate for 10 minutes at room temperature.
  4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom.
  5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C.

Reference Data

• RefSeq: NM_032965.6
• RefSeq Size: 955 bp
• RefSeq ORF: 342 bp
• Locus ID: 6359
• UniProt ID: Q16663
• Cytogenetics: 17q12
• Domains: IL8
• Protein Families: Druggable Genome, Secreted Protein, Transmembrane
• Protein Pathways: Chemokine signaling pathway, Cytokine-cytokine receptor interaction
• MW: 10.1 kDa
• Gene Summary: This gene is located in a cluster of similar genes in the same region of chromosome 17. These genes encode CC cytokines, which are secreted proteins characterized by two adjacent cysteines. The product of this gene is chemotactic for T cells and monocytes, and acts through C-C chemokine receptor type 1 (CCR1). The proprotein is further processed into numerous smaller functional peptides. Naturally-occurring readthrough transcripts occur from this gene into the downstream gene, CCL14 (chemokine (C-C motif) ligand 14). [provided by RefSeq, Jan 2013]