OTUD7A (NM_130901) Human Tagged ORF Clone

CAT#: RC213015

Reviews ()
Write a review

OTUD7A (Myc-DDK-tagged)-Human OTU domain containing 7A (OTUD7A)



  "NM_130901" in other vectors (6)

Reconstitution Protocol

Special Offer: 20% off the control vector (empty cloning vector without insert). Use code "Shuttle20".

USD 1,168.00


Availability*
In Stock

Size
    • 10 ug


Product images

Specifications

Product Data
Type Human Tagged ORF Clone
Tag Myc-DDK
Symbol OTUD7A
Synonyms C15orf16; C16ORF15; CEZANNE2; OTUD7
Vector pCMV6-Entry
E. coli Selection Kanamycin (25 ug/mL)
Mammalian Cell Selection Neomycin
Sequence Data
>RC213015 representing NM_130901
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGGTTTCTAGTGTGCTTCCAAACCCCACCTCGGCTGAGTGTTGGGCAGCACTTCTACATGATCCTATGA
CTCTTGATATGGACGCAGTCCTGTCAGACTTTGTTCGGTCCACGGGGGCAGAACCTGGTCTGGCCAGAGA
CCTGCTGGAAGGCAAAAACTGGGACCTGACAGCCGCTCTGAGCGACTATGAGCAGCTCCGCCAGGTGCAC
ACAGCCAATCTGCCACATGTGTTCAATGAAGGGCGGGGTCCCAAGCAGCCAGAGCGAGAGCCACAGCCCG
GGCACAAGGTGGAGCGACCCTGCCTGCAGAGGCAGGACGACATTGCCCAAGAAAAGCGGCTTTCCCGGGG
GATTTCCCACGCCAGCTCAGCCATCGTCTCCCTGGCCCGGTCCCACGTGGCAAGTGAATGCAACAACGAG
CAGTTCCCCCTGGAGATGCCAATCTACACATTCCAGTTGCCAGACCTGAGCGTGTACAGCGAGGATTTCA
GGAGCTTCATCGAGCGGGACTTGATCGAGCAGGCAACAATGGTGGCTTTGGAGCAGGCAGGTCGCCTGAA
CTGGTGGTCCACTGTGTGCACGAGCTGTAAACGGCTTCTTCCTCTGGCCACAACAGGGGATGGGAACTGC
CTTTTACATGCTGCTTCACTGGGAATGTGGGGGTTTCACGACCGGGACCTGGTGTTACGGAAAGCTCTCT
ATACCATGATGAGGACGGGAGCTGAGAGGGAAGCCCTGAAGCGGAGGTGGAGGTGGCAGCAGACGCAGCA
GAATAAGGAGGAGGAGTGGGAGCGGGAGTGGACGGAGCTGCTGAAGCTGGCCTCCAGCGAGCCGCGCACA
CACTTCAGCAAGAATGGCGGCACGGGCGGGGGTGTGGACAACTCTGAGGACCCCGTGTACGAGAGCCTGG
AAGAGTTCCACGTTTTTGTCCTAGCCCATATATTAAGAAGGCCCATCGTTGTTGTGGCAGATACAATGTT
AAGAGACTCAGGTGGAGAAGCGTTCGCACCCATCCCATTCGGAGGGATCTACCTGCCCTTGGAGGTCCCT
CCCAACAGATGCCACTGCTCGCCTCTGGTTCTGGCCTATGATCAAGCCCATTTCTCTGCCCTTGTGTCCA
TGGAACAGAGAGACCAGCAAAGAGAACAAGCCGTGATCCCCCTGACGGATTCTGAGCACAAGCTGCTGCC
TCTGCACTTTGCAGTGGACCCTGGCAAGGACTGGGAGTGGGGGAAAGACGACAACGATAACGCCCGGCTG
GCCCACCTTATCCTGTCGCTAGAAGCCAAGCTGAACCTTCTGCACAGCTACATGAACGTGACGTGGATCC
GGATCCCCTCCGAGACACGGGCGCCCCTGGCACAGCCGGAGTCTCCCACGGCCTCGGCAGGGGAGGACGT
GCAGTCCCTGGCCGACTCGCTGGACTCGGACCGCGATTCGGTGTGCAGCAATTCTAACAGCAATAACGGC
AAGAACGGCAAGGACAAGGAGAAGGAGAAGCAGCGCAAGGAGAAGGACAAGACGCGCGCCGACTCCGTGG
CCAACAAGCTGGGCAGCTTCAGCAAGACGCTGGGCATCAAGCTGAAGAAAAACATGGGCGGCCTCGGCGG
CCTGGTGCACGGCAAGATGGGCCGCGCCAACTCCGCCAATGGCAAGAACGGGGACTCGGCCGAGCGGGGC
AAGGAGAAGAAGGCCAAGTCGCGCAAGGGCAGCAAGGAGGAGTCTGGTGCGTCGGCCAGCACGTCGCCGT
CGGAAAAGACCACGCCGTCGCCCACAGACAAGGCAGCGGGCGCGTCGCCGGCGGAGAAGGGCGGTGGGCC
GCGGGGCGACGCCTGGAAGTACAGCACGGATGTGAAGCTGAGCCTCAACATCCTGCGCGCCGCCATGCAG
GGGGAGCGCAAGTTCATCTTCGCCGGCCTGCTGCTCACCAGCCACCGGCACCAGTTCCACGAGGAGATGA
TCGGCTACTACCTGACGAGCGCGCAGGAGCGCTTCAGCGCCGAGCAGGAGCAGCGGCGCCGCGACGCCGC
TACTGCGGCCGCCGCTGCCGCCGCCGCCGCCGCCGCCACGGCCAAGCGGCCGCCGCGCAGACCGGAGACG
GAGGGCGTGCCGGTCCCGGAGCGCGCCTCTCCGGGCCCACCCACGCAGCTGGTGCTCAAGCTCAAGGAGC
GGCCGAGCCCCGGGCCCGCGGCAGGGCGTGCGGCGCGGGCGGCGGCGGGCGGCACGGCCTCCCCGGGGGG
AGGCGCGCGGCGTGCGAGCGCCAGCGGACCAGTGCCTGGCCGCAGCCCCCCGGCGCCAGCGCGCCAGAGC
GTCATCCACGTGCAGGCGTCGGGCGCGCGGGACGAGGCGTGCGCGCCGGCCGTGGGGGCGCTGCGGCCGT
GCGCCACGTACCCGCAGCAGAACCGCTCGCTGTCGTCGCAGAGCTACAGCCCGGCGCGCGCCGCCGCCCT
GCGCACCGTCAACACGGTCGAGTCGCTGGCGCGCGCGGTGCCCGGGGCCCTACCGGGCGCGGCGGGGACG
GCGGGGGCGGCCGAGCACAAGTCGCAGACCTACACCAACGGCTTCGGCGCCCTGCGCGACGGCCTGGAGT
TCGCCGACGCCGACGCGCCGACCGCGCGCTCGAACGGTGAGTGCGGCCGTGGCGGCCCGGGGCCGGTGCA
GCGGCGCTGCCAGCGCGAGAACTGTGCGTTCTACGGGCGCGCCGAGACCGAGCACTACTGCTCCTACTGC
TACCGCGAGGAGCTGCGGCGGCGGCGCGAGGCGCGCGGGGCCCGGCCC


ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT
ACAAGGATGACGACGATAAG
GTTTAA
>RC213015 representing NM_130901
Red=Cloning site Green=Tags(s)

MVSSVLPNPTSAECWAALLHDPMTLDMDAVLSDFVRSTGAEPGLARDLLEGKNWDLTAALSDYEQLRQVH
TANLPHVFNEGRGPKQPEREPQPGHKVERPCLQRQDDIAQEKRLSRGISHASSAIVSLARSHVASECNNE
QFPLEMPIYTFQLPDLSVYSEDFRSFIERDLIEQATMVALEQAGRLNWWSTVCTSCKRLLPLATTGDGNC
LLHAASLGMWGFHDRDLVLRKALYTMMRTGAEREALKRRWRWQQTQQNKEEEWEREWTELLKLASSEPRT
HFSKNGGTGGGVDNSEDPVYESLEEFHVFVLAHILRRPIVVVADTMLRDSGGEAFAPIPFGGIYLPLEVP
PNRCHCSPLVLAYDQAHFSALVSMEQRDQQREQAVIPLTDSEHKLLPLHFAVDPGKDWEWGKDDNDNARL
AHLILSLEAKLNLLHSYMNVTWIRIPSETRAPLAQPESPTASAGEDVQSLADSLDSDRDSVCSNSNSNNG
KNGKDKEKEKQRKEKDKTRADSVANKLGSFSKTLGIKLKKNMGGLGGLVHGKMGRANSANGKNGDSAERG
KEKKAKSRKGSKEESGASASTSPSEKTTPSPTDKAAGASPAEKGGGPRGDAWKYSTDVKLSLNILRAAMQ
GERKFIFAGLLLTSHRHQFHEEMIGYYLTSAQERFSAEQEQRRRDAATAAAAAAAAAAATAKRPPRRPET
EGVPVPERASPGPPTQLVLKLKERPSPGPAAGRAARAAAGGTASPGGGARRASASGPVPGRSPPAPARQS
VIHVQASGARDEACAPAVGALRPCATYPQQNRSLSSQSYSPARAAALRTVNTVESLARAVPGALPGAAGT
AGAAEHKSQTYTNGFGALRDGLEFADADAPTARSNGECGRGGPGPVQRRCQRENCAFYGRAETEHYCSYC
YREELRRRREARGARP

myc-FLAG tag
Chromatograms CHROMATOGRAMS
Sequencher program is needed, download here.
Restriction Sites SgfI-MluI      Cloning Scheme for this gene      Plasmid Map     
ACCN NM_130901
ORF Size 2778 bp
OTI Disclaimer The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Product Components The ORF clone is ion-exchange column purified and shipped in a 2D barcoded Matrix tube containing 10ug of transfection-ready, dried plasmid DNA (reconstitute with 100 ul of water).
Reconstitution 1. Centrifuge at 5,000xg for 5min.
2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA.
3. Close the tube and incubate for 10 minutes at room temperature.
4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom.
5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C.
Reference Data
RefSeq NM_130901.3
RefSeq Size 3042 bp
RefSeq ORF 2781 bp
Locus ID 161725
UniProt ID Q8TE49
Cytogenetics 15q13.3
Domains zf-A20
MW 100.5 kDa
Gene Summary The protein encoded by this gene is a deubiquitinizing enzyme and possible tumor suppressor. The encoded protein acts on TNF receptor associated factor 6 (TRAF6) to control nuclear factor kappa B expression. However, this gene is downregulated by SNAIL1 in hepatocellular carcinoma cells, contributing to their progression and malignancy. [provided by RefSeq, Aug 2016]

Other Versions

Other products for "OTUD7A"
Frequently bought together (4)
Clone OTI4C5, Anti-DDK (FLAG) monoclonal antibody
    • 30 ul

USD 165.00


pCMV6-Entry, mammalian vector with C-terminal Myc- DDK Tag, 10ug
    • 10 ug

USD 627.00


DH5α Chemically Competent Cells (≥10^8 cfu/μg of pUC19 DNA)
    • 5 x 200 ul

USD 149.00


Forward sequencing primer VP1.5, Reverse sequencing primer XL39, 100pmoles each
    • 100 pmol

USD 55.00

Customer Reviews 
Loading...
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.