FOLR2 (NM_000803) Human Tagged ORF Clone

CAT#: RC212993

FOLR2 (Myc-DDK-tagged)-Human folate receptor 2 (fetal) (FOLR2), transcript variant 1

Product Images

Circular map for RC212993

• 

  HEK293T cells were transfected with the pCMV6-ENTRY control (Cat# PS100001, Left lane) or pCMV6-ENTRY FOLR2 (Cat# RC212993, Right lane) cDNA for 48 hrs and lysed. Equivalent amounts of cell lysates (5 ug per lane) were separated by SDS-PAGE and immunoblotted with anti-FOLR2 (Cat# TA808026)(1:500). Positive lysates LY400280 (100ug) and LC400280 (20ug) can be purchased separately from OriGene.

• 

  Western blot validation of overexpression lysate (Cat# LY400280) using anti-DDK antibody (Cat# TA50011-100). Left: Cell lysates from un-transfected HEK293T cells; Right: Cell lysates from HEK293T cells transfected with RC212993 using transfection reagent MegaTran 2.0 (Cat# TT210002).

Specifications

Product Data

• Type: Human Tagged ORF Clone
• Tag: Myc-DDK
• Symbol: FOLR2
• Synonyms: BETA-HFR; FBP; FBP/PL-1; FOLR1; FR-BETA; FR-P3; FRbeta
• Vector: pCMV6-Entry
• E. coli Selection: Kanamycin (25 ug/mL)
• Mammalian Cell Selection: Neomycin
• Sequence Data:
  ORF Nucleotide Sequence

  >RC212993 representing NM_000803
  Red=Cloning site Blue=ORF Green=Tags(s)
  
  TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
  GCCGCGATCGCC
  
  ATGGTCTGGAAATGGATGCCACTTCTGCTGCTTCTGGTCTGTGTAGCCACCATGTGCAGTGCCCAGGACA
  GGACTGATCTCCTCAATGTCTGTATGGATGCCAAGCACCACAAGACAAAGCCAGGTCCTGAGGACAAGCT
  GCATGACCAATGCAGTCCCTGGAAGAAGAATGCCTGCTGCACAGCCAGCACCAGCCAGGAGCTGCACAAG
  GACACCTCCCGCCTGTACAACTTTAACTGGGACCACTGCGGCAAGATGGAGCCCGCCTGCAAGCGCCACT
  TCATCCAGGACACCTGTCTCTATGAGTGCTCACCCAACCTGGGGCCCTGGATCCAGCAGGTGAATCAGAG
  CTGGCGCAAAGAACGCTTCCTGGATGTGCCCTTATGCAAAGAGGACTGTCAGCGCTGGTGGGAGGATTGT
  CACACCTCCCACACGTGCAAGAGCAACTGGCACAGAGGATGGGACTGGACCTCAGGAGTTAACAAGTGCC
  CAGCTGGGGCTCTCTGCCGCACCTTTGAGTCCTACTTCCCCACTCCAGCTGCCCTTTGTGAAGGCCTCTG
  GAGTCACTCATACAAGGTCAGCAACTACAGCCGAGGGAGCGGCCGCTGCATCCAGATGTGGTTTGATTCA
  GCCCAGGGCAACCCCAACGAGGAAGTGGCGAGGTTCTATGCTGCAGCCATGCATGTGAATGCTGGTGAGA
  TGCTTCATGGGACTGGGGGTCTCCTGCTCAGTCTGGCCCTGATGCTGCAACTCTGGCTCCTTGGC
  
  ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT
  ACAAGGATGACGACGATAAGGTTTAA
  Protein Sequence

  >RC212993 representing NM_000803
  Red=Cloning site Green=Tags(s)
  
  MVWKWMPLLLLLVCVATMCSAQDRTDLLNVCMDAKHHKTKPGPEDKLHDQCSPWKKNACCTASTSQELHK
  DTSRLYNFNWDHCGKMEPACKRHFIQDTCLYECSPNLGPWIQQVNQSWRKERFLDVPLCKEDCQRWWEDC
  HTSHTCKSNWHRGWDWTSGVNKCPAGALCRTFESYFPTPAALCEGLWSHSYKVSNYSRGSGRCIQMWFDS
  AQGNPNEEVARFYAAAMHVNAGEMLHGTGGLLLSLALMLQLWLLG
  
  myc-FLAG tag
• Restriction Sites: SgfI-MluI Cloning Scheme for this gene Plasmid Map
• ACCN: NM_000803
• ORF Size: 765 bp
• OTI Disclaimer: The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
• OTI Annotation: This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
• Product Components: The ORF clone is ion-exchange column purified and shipped in a 2D barcoded Matrix tube containing 10ug of transfection-ready, dried plasmid DNA (reconstitute with 100 ul of water).
• Reconstitution: 1. Centrifuge at 5,000xg for 5min.
  2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA.
  3. Close the tube and incubate for 10 minutes at room temperature.
  4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom.
  5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C.

Reference Data

• RefSeq: NM_000803.5
• RefSeq Size: 1119 bp
• RefSeq ORF: 768 bp
• Locus ID: 2350
• UniProt ID: P14207
• Cytogenetics: 11q13.4
• Domains: Folate_rec
• Protein Families: Druggable Genome, Secreted Protein
• MW: 29.1 kDa
• Gene Summary: The protein encoded by this gene is a member of the folate receptor (FOLR) family, and these genes exist in a cluster on chromosome 11. Members of this gene family have a high affinity for folic acid and for several reduced folic acid derivatives, and they mediate delivery of 5-methyltetrahydrofolate to the interior of cells. This protein has a 68% and 79% sequence homology with the FOLR1 and FOLR3 proteins, respectively. Although this protein was originally thought to be specific to placenta, it can also exist in other tissues, and it may play a role in the transport of methotrexate in synovial macrophages in rheumatoid arthritis patients. Multiple transcript variants that encode the same protein have been found for this gene. [provided by RefSeq, Jul 2008]