HRH4 (NM_021624) Human Tagged ORF Clone

CAT#: RC212974

HRH4 (Myc-DDK-tagged)-Human histamine receptor H4 (HRH4), transcript variant 1

Clone Modification / Custom Cloning Service

USD 577.00


Availability*
In Stock

Size
    • 10 ug

Product images

Specifications

Product Data
Product Name HRH4 (NM_021624) Human Tagged ORF Clone
Symbol HRH4
Synonyms AXOR35; BG26; GPCR105; GPRv53; H4; H4R; HH4R
Vector pCMV6-Entry
Sequence Data
>RC212974 representing NM_021624
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGCCAGATACTAATAGCACAATCAATTTATCACTAAGCACTCGTGTTACTTTAGCATTTTTTATGTCCT
TAGTAGCTTTTGCTATAATGCTAGGAAATGCTTTGGTCATTTTAGCTTTTGTGGTGGACAAAAACCTTAG
ACATCGAAGTAGTTATTTTTTTCTTAACTTGGCCATCTCTGACTTCTTTGTGGGTGTGATCTCCATTCCT
TTGTACATCCCTCACACGCTGTTCGAATGGGATTTTGGAAAGGAAATCTGTGTATTTTGGCTCACTACTG
ACTATCTGTTATGTACAGCATCTGTATATAACATTGTCCTCATCAGCTATGATCGATACCTGTCAGTCTC
AAATGCTGTGTCTTATAGAACTCAACATACTGGGGTCTTGAAGATTGTTACTCTGATGGTGGCCGTTTGG
GTGCTGGCCTTCTTAGTGAATGGGCCAATGATTCTAGTTTCAGAGTCTTGGAAGGATGAAGGTAGTGAAT
GTGAACCTGGATTTTTTTCGGAATGGTACATCCTTGCCATCACATCATTCTTGGAATTCGTGATCCCAGT
CATCTTAGTCGCTTATTTCAACATGAATATTTATTGGAGCCTGTGGAAGCGTGATCATCTCAGTAGGTGC
CAAAGCCATCCTGGACTGACTGCTGTCTCTTCCAACATCTGTGGACACTCATTCAGAGGTAGACTATCTT
CAAGGAGATCTCTTTCTGCATCGACAGAAGTTCCTGCATCCTTTCATTCAGAGAGACAGAGGAGAAAGAG
TAGTCTCATGTTTTCCTCAAGAACCAAGATGAATAGCAATACAATTGCTTCCAAAATGGGTTCCTTCTCC
CAATCAGATTCTGTAGCTCTTCACCAAAGGGAACATGTTGAACTGCTTAGAGCCAGGAGATTAGCCAAGT
CACTGGCCATTCTCTTAGGGGTTTTTGCTGTTTGCTGGGCTCCATATTCTCTGTTCACAATTGTCCTTTC
ATTTTATTCCTCAGCAACAGGTCCTAAATCAGTTTGGTATAGAATTGCATTTTGGCTTCAGTGGTTCAAT
TCCTTTGTCAATCCTCTTTTGTATCCATTGTGTCACAAGCGCTTTCAAAAGGCTTTCTTGAAAATATTTT
GTATAAAAAAGCAACCTCTACCATCACAACACAGTCGGTCAGTATCTTCT


ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT
ACAAGGATGACGACGATAAG
GTTTAA
>RC212974 representing NM_021624
Red=Cloning site Green=Tags(s)

MPDTNSTINLSLSTRVTLAFFMSLVAFAIMLGNALVILAFVVDKNLRHRSSYFFLNLAISDFFVGVISIP
LYIPHTLFEWDFGKEICVFWLTTDYLLCTASVYNIVLISYDRYLSVSNAVSYRTQHTGVLKIVTLMVAVW
VLAFLVNGPMILVSESWKDEGSECEPGFFSEWYILAITSFLEFVIPVILVAYFNMNIYWSLWKRDHLSRC
QSHPGLTAVSSNICGHSFRGRLSSRRSLSASTEVPASFHSERQRRKSSLMFSSRTKMNSNTIASKMGSFS
QSDSVALHQREHVELLRARRLAKSLAILLGVFAVCWAPYSLFTIVLSFYSSATGPKSVWYRIAFWLQWFN
SFVNPLLYPLCHKRFQKAFLKIFCIKKQPLPSQHSRSVSS

myc-FLAG tag
Chromatograms CHROMATOGRAMS
Sequencher program is needed, download here.
Restriction Sites SgfI-MluI      Cloning Scheme for this gene      Plasmid Map     
Tag Myc-DDK
ACCN NM_021624
ORF Size 1170 bp
OTI Disclaimer The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Product Components The ORF clone is ion-exchange column purified, transfection-ready dried plasmid DNA, and shipped with 2 vector sequencing primers.
Reference Data
RefSeq NM_021624.1, NM_021624.2, NM_021624.3, NP_067637
RefSeq Size 3689
RefSeq ORF 1173
Locus ID 59340
Cytogenetics 18q11.2
Protein Families GPCR, Transmembrane, Druggable Genome
Protein Pathways Neuroactive ligand-receptor interaction
MW 44.3 kDa
Gene Summary Histamine is a ubiquitous messenger molecule released from mast cells, enterochromaffin-like cells, and neurons. Its various actions are mediated by a family of histamine receptors, which are a subset of the G-protein coupled receptor superfamily. This gene encodes a histamine receptor that is predominantly expressed in haematopoietic cells. The protein is thought to play a role in inflammation and allergy reponses. Multiple transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq, May 2009].
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Citations (1)