HMGN2 (NM_005517) Human Tagged ORF Clone

CAT#: RC212821

HMGN2 (Myc-DDK-tagged)-Human high mobility group nucleosomal binding domain 2 (HMGN2)

Clone Modification / Custom Cloning Service

  • TrueORF®

USD 402.00


Availability*
In Stock

Size
    • 10 ug

Product images

Specifications

Product Data
Product Name HMGN2 (NM_005517) Human Tagged ORF Clone
Symbol HMGN2
Synonyms HMG17; HMG17
Vector pCMV6-Entry
Sequence Data
ORF Nucleotide Sequence
>RC212821 representing NM_005517
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGCCCAAGAGAAAGGCTGAAGGGGATGCTAAGGGAGATAAAGCAAAGGTGAAGGACGAACCACAGAGAA
GATCCGCGAGGTTGTCTGCTAAACCTGCTCCTCCAAAGCCAGAGCCCAAGCCTAAAAAGGCCCCTGCAAA
GAAGGGAGAGAAGGTACCCAAAGGGAAAAAGGGAAAAGCTGATGCTGGCAAGGAGGGGAATAACCCTGCA
GAAAATGGAGATGCCAAAACAGACCAGGCACAGAAAGCTGAAGGTGCTGGAGATGCCAAG


ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT
ACAAGGATGACGACGATAAG
GTTTAA
Protein Sequence
>RC212821 representing NM_005517
Red=Cloning site Green=Tags(s)

MPKRKAEGDAKGDKAKVKDEPQRRSARLSAKPAPPKPEPKPKKAPAKKGEKVPKGKKGKADAGKEGNNPA
ENGDAKTDQAQKAEGAGDAK

myc-FLAG tag
Restriction Sites SgfI-MluI      Cloning Scheme for this gene      Plasmid Map     
Tag Myc-DDK
ACCN NM_005517
ORF Size 270 bp
OTI Disclaimer The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Product Components The ORF clone is ion-exchange column purified, transfection-ready dried plasmid DNA, and shipped with 2 vector sequencing primers.
Reference Data
RefSeq NM_005517.1, NM_005517.2, NM_005517.3, NP_005508
RefSeq Size 1306
RefSeq ORF 273
Locus ID 3151
Cytogenetics 1p36.11
Domains HMG14_17
Protein Families Transcription Factors, Druggable Genome
MW 9.2 kDa
Gene Summary The protein encoded by this gene binds nucleosomal DNA and is associated with transcriptionally active chromatin. Along with a similar protein, HMGN1, the encoded protein may help maintain an open chromatin configuration around transcribable genes. The protein has also been found to have antimicrobial activity against bacteria, viruses and fungi. [provided by RefSeq, Oct 2014].
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Citations