HMGN2 (NM_005517) Human Tagged ORF Clone

CAT#: RC212821

HMGN2 (Myc-DDK-tagged)-Human high mobility group nucleosomal binding domain 2 (HMGN2)

Specifications

Product Data

• Product Name: HMGN2 (NM_005517) Human Tagged ORF Clone
• Symbol: HMGN2
• Synonyms: HMG17; HMG17
• Vector: pCMV6-Entry
• Sequence Data:
  ORF Nucleotide Sequence

  >RC212821 representing NM_005517
  Red=Cloning site Blue=ORF Green=Tags(s)
  
  TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
  GCCGCGATCGCC
  
  ATGCCCAAGAGAAAGGCTGAAGGGGATGCTAAGGGAGATAAAGCAAAGGTGAAGGACGAACCACAGAGAA
  GATCCGCGAGGTTGTCTGCTAAACCTGCTCCTCCAAAGCCAGAGCCCAAGCCTAAAAAGGCCCCTGCAAA
  GAAGGGAGAGAAGGTACCCAAAGGGAAAAAGGGAAAAGCTGATGCTGGCAAGGAGGGGAATAACCCTGCA
  GAAAATGGAGATGCCAAAACAGACCAGGCACAGAAAGCTGAAGGTGCTGGAGATGCCAAG
  
  ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT
  ACAAGGATGACGACGATAAGGTTTAA
  Protein Sequence

  >RC212821 representing NM_005517
  Red=Cloning site Green=Tags(s)
  
  MPKRKAEGDAKGDKAKVKDEPQRRSARLSAKPAPPKPEPKPKKAPAKKGEKVPKGKKGKADAGKEGNNPA
  ENGDAKTDQAQKAEGAGDAK
  
  myc-FLAG tag
• Restriction Sites: SgfI-MluI Cloning Scheme for this gene Plasmid Map
• Tag: Myc-DDK
• ACCN: NM_005517
• ORF Size: 270 bp
• OTI Disclaimer: The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
• OTI Annotation: This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
• Product Components: The ORF clone is ion-exchange column purified, transfection-ready dried plasmid DNA, and shipped with 2 vector sequencing primers.

Reference Data

• RefSeq: NM_005517.1, NM_005517.2, NM_005517.3, NP_005508
• RefSeq Size: 1306
• RefSeq ORF: 273
• Locus ID: 3151
• Cytogenetics: 1p36.11
• Domains: HMG14_17
• Protein Families: Transcription Factors, Druggable Genome
• MW: 9.2 kDa
• Gene Summary: The protein encoded by this gene binds nucleosomal DNA and is associated with transcriptionally active chromatin. Along with a similar protein, HMGN1, the encoded protein may help maintain an open chromatin configuration around transcribable genes. The protein has also been found to have antimicrobial activity against bacteria, viruses and fungi. [provided by RefSeq, Oct 2014].