DEGS1 (NM_003676) Human Tagged ORF Clone

SKU
RC212803
DEGS1 (Myc-DDK-tagged)-Human degenerative spermatocyte homolog 1, lipid desaturase (Drosophila) (DEGS1)
  • TrueORF Gold

    Protein expression verified by Western blot, fully sequenced and in stock

    Click here to learn more.

$300.00
In Stock*
Specifications
Product Data
Type Human Tagged ORF Clone
Target Symbol DEGS1
Synonyms DEGS; DEGS-1; Des-1; DES1; FADS7; HLD18; MIG15; MLD
Vector pCMV6-Entry
E. coli Selection Kanamycin (25 ug/mL)
Mammalian Cell Selection Neomycin
Sequence Data
ORF Nucleotide Sequence
>RC212803 ORF sequence
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGGGGAGCCGCGTCTCGCGGGAAGACTTCGAGTGGGTCTACACCGACCAGCCGCACGCCGACCGGCGCC
GGGAGATCCTGGCAAAGTATCCAGAGATAAAGTCCTTGATGAAACCTGATCCCAATTTGATATGGATTAT
AATTATGATGGTTCTCACCCAGTTGGGTGCATTTTACATAGTAAAAGACTTGGACTGGAAATGGGTCATA
TTTGGGGCCTATGCGTTTGGCAGTTGCATTAACCACTCAATGACTCTGGCTATTCATGAGATTGCCCACA
ATGCTGCCTTTGGCAACTGCAAAGCAATGTGGAATCGCTGGTTTGGAATGTTTGCTAATCTTCCTATTGG
GATTCCATATTCAATTTCCTTTAAGAGGTATCACATGGATCATCATCGGTACCTTGGAGCTGATGGCGTC
GATGTAGATATTCCTACCGATTTTGAGGGCTGGTTCTTCTGTACCGCTTTCAGAAAGTTTATATGGGTTA
TTCTTCAGCCTCTCTTTTATGCCTTTCGACCTCTGTTCATCAACCCCAAACCAATTACGTATCTGGAAGT
TATCAATACCGTGGCACAGGTCACTTTTGACATTTTAATTTATTACTTTTTGGGAATTAAATCCTTAGTC
TACATGTTGGCAGCATCTTTACTTGGCCTGGGTTTGCACCCAATTTCTGGACATTTTATAGCTGAGCATT
ACATGTTCTTAAAGGGTCATGAAACTTACTCATATTATGGGCCTCTGAATTTACTTACCTTCAATGTGGG
TTATCATAATGAACATCATGATTTCCCCAACATTCCTGGAAAAAGTCTTCCACTGGTGAGGAAAATAGCA
GCTGAATACTATGACAACCTCCCTCACTACAATTCCTGGATAAAAGTACTGTATGATTTTGTGATGGATG
ATACAATAAGTCCCTACTCAAGAATGAAGAGGCACCAAAAAGGAGAGATGGTGCTGGAG


ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT
ACAAGGATGACGACGATAAG
GTTTAA
Protein Sequence
>RC212803 protein sequence
Red=Cloning site Green=Tags(s)

MGSRVSREDFEWVYTDQPHADRRREILAKYPEIKSLMKPDPNLIWIIIMMVLTQLGAFYIVKDLDWKWVI
FGAYAFGSCINHSMTLAIHEIAHNAAFGNCKAMWNRWFGMFANLPIGIPYSISFKRYHMDHHRYLGADGV
DVDIPTDFEGWFFCTAFRKFIWVILQPLFYAFRPLFINPKPITYLEVINTVAQVTFDILIYYFLGIKSLV
YMLAASLLGLGLHPISGHFIAEHYMFLKGHETYSYYGPLNLLTFNVGYHNEHHDFPNIPGKSLPLVRKIA
AEYYDNLPHYNSWIKVLYDFVMDDTISPYSRMKRHQKGEMVLE

myc-FLAG tag
Chromatograms Chromatograms
Sequencher program is needed, download here
Restriction Sites SgfI-MluI Cloning Scheme for this gene Plasmid Map
ACCN NM_003676
ORF Size 969 bp
OTI Disclaimer The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Components The ORF clone is ion-exchange column purified and shipped in a 2D barcoded Matrix tube containing 10ug of transfection-ready, dried plasmid DNA (reconstitute with 100 ul of water).
Reconstitution Method 1. Centrifuge at 5,000xg for 5min.
2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA.
3. Close the tube and incubate for 10 minutes at room temperature.
4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom.
5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C.
Note Plasmids are not sterile.  For experiments where strict sterility is required, filtration with 0.22um filter is required.
Shipping Ambient
Reference Data
RefSeq NM_003676.4
RefSeq Size 2101 bp
RefSeq ORF 972 bp
Locus ID 8560
UniProt ID O15121
Cytogenetics 1q42.11
Domains FA_desaturase
Protein Families Druggable Genome, Transmembrane
Protein Pathways Metabolic pathways, Sphingolipid metabolism
MW 37.9 kDa
Summary This gene encodes a member of the membrane fatty acid desaturase family which is responsible for inserting double bonds into specific positions in fatty acids. This protein contains three His-containing consensus motifs that are characteristic of a group of membrane fatty acid desaturases. It is predicted to be a multiple membrane-spanning protein localized to the endoplasmic reticulum. Overexpression of this gene inhibited biosynthesis of the EGF receptor, suggesting a possible role of a fatty acid desaturase in regulating biosynthetic processing of the EGF receptor. [provided by RefSeq, Mar 2010]
Write Your Own Review
You're reviewing:DEGS1 (NM_003676) Human Tagged ORF Clone
Your Rating
SKU Description Size Price
RC212803L1 Lenti ORF clone of Human degenerative spermatocyte homolog 1, lipid desaturase (Drosophila) (DEGS1), Myc-DDK-tagged 10 ug
$600.00
RC212803L2 Lenti ORF clone of Human degenerative spermatocyte homolog 1, lipid desaturase (Drosophila) (DEGS1), mGFP tagged 10 ug
$600.00
RC212803L3 Lenti ORF clone of Human degenerative spermatocyte homolog 1, lipid desaturase (Drosophila) (DEGS1), Myc-DDK-tagged 10 ug
$600.00
RC212803L4 Lenti ORF clone of Human degenerative spermatocyte homolog 1, lipid desaturase (Drosophila) (DEGS1), mGFP tagged 10 ug
$600.00
RG212803 DEGS1 (tGFP-tagged) - Human degenerative spermatocyte homolog 1, lipid desaturase (Drosophila) (DEGS1) 10 ug
$489.00 MSRP $500.00 MSRP $500.00
SC117856 DEGS1 (untagged)-Human degenerative spermatocyte homolog 1, lipid desaturase (Drosophila) (DEGS1) 10 ug
$300.00

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.