BMP3 (NM_001201) Human Tagged ORF Clone

CAT#: RC212801

Reviews ()
Write a review

BMP3 (Myc-DDK-tagged)-Human bone morphogenetic protein 3 (BMP3)



Reconstitution Protocol

Special Offer: 20% off the control vector (empty cloning vector without insert). Use code "Shuttle20".

USD 477.00


Availability*
In Stock

Size
    • 10 ug


Product images

Specifications

Product Data
Type Human Tagged ORF Clone
Tag Myc-DDK
Symbol BMP3
Synonyms BMP-3A
Vector pCMV6-Entry
E. coli Selection Kanamycin (25 ug/mL)
Mammalian Cell Selection Neomycin
Sequence Data
>RC212801 representing NM_001201
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGGCTGGGGCGAGCAGGCTGCTCTTTCTGTGGCTGGGCTGCTTCTGCGTGAGCCTGGCGCAGGGAGAGA
GACCGAAGCCACCTTTCCCGGAGCTCCGCAAAGCTGTGCCAGGTGACCGCACGGCAGGTGGTGGCCCGGA
CTCCGAGCTGCAGCCGCAAGACAAGGTCTCTGAACACATGCTGCGGCTCTATGACAGGTACAGCACGGTC
CAGGCGGCCCGGACACCGGGCTCCCTGGAGGGAGGCTCGCAGCCCTGGCGCCCTCGGCTCCTGCGCGAAG
GCAACACGGTTCGCAGCTTTCGGGCGGCAGCAGCAGAAACTCTTGAAAGAAAAGGACTGTATATCTTCAA
TCTGACATCGCTAACCAAGTCTGAAAACATTTTGTCTGCCACACTGTATTTCTGTATTGGAGAGCTAGGA
AACATCAGCCTGAGTTGTCCAGTGTCTGGAGGATGCTCCCATCATGCTCAGAGGAAACACATTCAGATTG
ATCTTTCTGCATGGACCCTCAAATTCAGCAGAAACCAAAGTCAACTCCTTGGCCATCTGTCAGTGGATAT
GGCCAAATCTCATCGAGATATTATGTCCTGGCTGTCTAAAGATATCACTCAATTCTTGAGGAAGGCCAAA
GAAAATGAAGAGTTCCTCATAGGATTTAACATTACGTCCAAGGGACGCCAGCTGCCAAAGAGGAGGTTAC
CTTTTCCAGAGCCTTATATCTTGGTATATGCCAATGATGCCGCCATTTCTGAGCCAGAAAGTGTGGTATC
AAGCTTACAGGGACACCGGAATTTTCCCACTGGAACTGTTCCCAAATGGGATAGCCACATCAGAGCTGCC
CTTTCCATTGAGCGGAGGAAGAAGCGCTCTACTGGGGTCTTGCTGCCTCTGCAGAACAACGAGCTTCCTG
GGGCAGAATACCAGTATAAAAAGGATGAGGTGTGGGAGGAGAGAAAGCCTTACAAGACCCTTCAGGCTCA
GGCCCCTGAAAAGAGTAAGAATAAAAAGAAACAGAGAAAGGGGCCTCATCGGAAGAGCCAGACGCTCCAA
TTTGATGAGCAGACCCTGAAAAAGGCAAGGAGAAAGCAGTGGATTGAACCTCGGAATTGCGCCAGGAGAT
ACCTCAAGGTAGACTTTGCAGATATTGGCTGGAGTGAATGGATTATCTCCCCCAAGTCCTTTGATGCCTA
TTATTGCTCTGGAGCATGCCAGTTCCCCATGCCAAAGTCTTTGAAGCCATCAAATCATGCTACCATCCAG
AGTATAGTGAGAGCTGTGGGGGTCGTTCCTGGGATTCCTGAGCCTTGCTGTGTACCAGAAAAGATGTCCT
CACTCAGTATTTTATTCTTTGATGAAAATAAGAATGTAGTGCTTAAAGTATACCCTAACATGACAGTAGA
GTCTTGCGCTTGCAGA


ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT
ACAAGGATGACGACGATAAG
GTTTAA
>RC212801 representing NM_001201
Red=Cloning site Green=Tags(s)

MAGASRLLFLWLGCFCVSLAQGERPKPPFPELRKAVPGDRTAGGGPDSELQPQDKVSEHMLRLYDRYSTV
QAARTPGSLEGGSQPWRPRLLREGNTVRSFRAAAAETLERKGLYIFNLTSLTKSENILSATLYFCIGELG
NISLSCPVSGGCSHHAQRKHIQIDLSAWTLKFSRNQSQLLGHLSVDMAKSHRDIMSWLSKDITQFLRKAK
ENEEFLIGFNITSKGRQLPKRRLPFPEPYILVYANDAAISEPESVVSSLQGHRNFPTGTVPKWDSHIRAA
LSIERRKKRSTGVLLPLQNNELPGAEYQYKKDEVWEERKPYKTLQAQAPEKSKNKKKQRKGPHRKSQTLQ
FDEQTLKKARRKQWIEPRNCARRYLKVDFADIGWSEWIISPKSFDAYYCSGACQFPMPKSLKPSNHATIQ
SIVRAVGVVPGIPEPCCVPEKMSSLSILFFDENKNVVLKVYPNMTVESCACR

myc-FLAG tag
Chromatograms CHROMATOGRAMS
Sequencher program is needed, download here.
Restriction Sites SgfI-MluI      Cloning Scheme for this gene      Plasmid Map     
ACCN NM_001201
ORF Size 1416 bp
OTI Disclaimer The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Product Components The ORF clone is ion-exchange column purified and shipped in a 2D barcoded Matrix tube containing 10ug of transfection-ready, dried plasmid DNA (reconstitute with 100 ul of water).
Reconstitution 1. Centrifuge at 5,000xg for 5min.
2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA.
3. Close the tube and incubate for 10 minutes at room temperature.
4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom.
5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C.
Reference Data
RefSeq NM_001201.4
RefSeq Size 1774 bp
RefSeq ORF 1419 bp
Locus ID 651
UniProt ID P12645
Cytogenetics 4q21.21
Protein Families Druggable Genome, Secreted Protein
MW 53.41 kDa
Gene Summary This gene encodes a secreted ligand of the TGF-beta (transforming growth factor-beta) superfamily of proteins. Ligands of this family bind various TGF-beta receptors leading to recruitment and activation of SMAD family transcription factors that regulate gene expression. The encoded preproprotein is proteolytically processed to generate each subunit of the disulfide-linked homodimer. This protein suppresses osteoblast differentiation, and negatively regulates bone density, by modulating TGF-beta receptor availability to other ligands. [provided by RefSeq, Jul 2016]
Other products for "BMP3"
Customer Reviews 
Loading...
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.