CHRM2 (NM_000739) Human Tagged ORF Clone

CAT#: RC212791

Reviews ()
Write a review

CHRM2 (Myc-DDK-tagged)-Human cholinergic receptor, muscarinic 2 (CHRM2), transcript variant 4



  "NM_000739" in other vectors (6)

Special Offer: 20% off the control vector (empty cloning vector without insert). Use code "Shuttle20".

USD 477.00


Availability*
In Stock

Size
    • 10 ug


Product images

Specifications

Product Data
Type Human Tagged ORF Clone
Tag Myc-DDK
Symbol CHRM2
Synonyms HM2
Vector pCMV6-Entry
E. coli Selection Kanamycin (25 ug/mL)
Mammalian Cell Selection Neomycin
Sequence Data
>RC212791 representing NM_000739
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGAATAACTCAACAAACTCCTCTAACAATAGCCTGGCTCTTACAAGTCCTTATAAGACATTTGAAGTGG
TGTTTATTGTCCTGGTGGCTGGATCCCTCAGTTTGGTGACCATTATCGGGAACATCCTAGTCATGGTTTC
CATTAAAGTCAACCGCCACCTCCAGACCGTCAACAATTACTTTTTATTCAGCTTGGCCTGTGCTGACCTT
ATCATAGGTGTTTTCTCCATGAACTTGTACACCCTCTACACTGTGATTGGTTACTGGCCTTTGGGACCTG
TGGTGTGTGACCTTTGGCTAGCCCTGGACTATGTGGTCAGCAATGCCTCAGTTATGAATCTGCTCATCAT
CAGCTTTGACAGGTACTTCTGTGTCACAAAACCTCTGACCTACCCAGTCAAGCGGACCACAAAAATGGCA
GGTATGATGATTGCAGCTGCCTGGGTCCTCTCTTTCATCCTCTGGGCTCCAGCCATTCTCTTCTGGCAGT
TCATTGTAGGGGTGAGAACTGTGGAGGATGGGGAGTGCTACATTCAGTTTTTTTCCAATGCTGCTGTCAC
CTTTGGTACGGCTATTGCAGCCTTCTATTTGCCAGTGATCATCATGACTGTGCTATATTGGCACATATCC
CGAGCCAGCAAGAGCAGGATAAAGAAGGACAAGAAGGAGCCTGTTGCCAACCAAGACCCCGTTTCTCCAA
GTCTGGTACAAGGAAGGATAGTGAAGCCAAACAATAACAACATGCCCAGCAGTGACGATGGCCTGGAGCA
CAACAAAATCCAGAATGGCAAAGCCCCCAGGGATCCTGTGACTGAAAACTGTGTTCAGGGAGAGGAGAAG
GAGAGCTCCAATGACTCCACCTCAGTCAGTGCTGTTGCCTCTAATATGAGAGATGATGAAATAACCCAGG
ATGAAAACACAGTTTCCACTTCCCTGGGCCATTCCAAAGATGAGAACTCTAAGCAAACATGCATCAGAAT
TGGCACCAAGACCCCAAAAAGTGACTCATGTACCCCAACTAATACCACCGTGGAGGTAGTGGGGTCTTCA
GGTCAGAATGGAGATGAAAAGCAGAATATTGTAGCCCGCAAGATTGTGAAGATGACTAAGCAGCCTGCAA
AAAAGAAGCCTCCTCCTTCCCGGGAAAAGAAAGTCACCAGGACAATCTTGGCTATTCTGTTGGCTTTCAT
CATCACTTGGGCCCCATACAATGTCATGGTGCTCATTAACACCTTTTGTGCACCTTGCATCCCCAACACT
GTGTGGACAATTGGTTACTGGCTTTGTTACATCAACAGCACTATCAACCCTGCCTGCTATGCACTTTGCA
ATGCCACCTTCAAGAAGACCTTTAAACACCTTCTCATGTGTCATTATAAGAACATAGGCGCTACAAGG


ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT
ACAAGGATGACGACGATAAG
GTTTAA
>RC212791 representing NM_000739
Red=Cloning site Green=Tags(s)

MNNSTNSSNNSLALTSPYKTFEVVFIVLVAGSLSLVTIIGNILVMVSIKVNRHLQTVNNYFLFSLACADL
IIGVFSMNLYTLYTVIGYWPLGPVVCDLWLALDYVVSNASVMNLLIISFDRYFCVTKPLTYPVKRTTKMA
GMMIAAAWVLSFILWAPAILFWQFIVGVRTVEDGECYIQFFSNAAVTFGTAIAAFYLPVIIMTVLYWHIS
RASKSRIKKDKKEPVANQDPVSPSLVQGRIVKPNNNNMPSSDDGLEHNKIQNGKAPRDPVTENCVQGEEK
ESSNDSTSVSAVASNMRDDEITQDENTVSTSLGHSKDENSKQTCIRIGTKTPKSDSCTPTNTTVEVVGSS
GQNGDEKQNIVARKIVKMTKQPAKKKPPPSREKKVTRTILAILLAFIITWAPYNVMVLINTFCAPCIPNT
VWTIGYWLCYINSTINPACYALCNATFKKTFKHLLMCHYKNIGATR

myc-FLAG tag
Chromatograms CHROMATOGRAMS
Sequencher program is needed, download here.
Restriction Sites SgfI-MluI      Cloning Scheme for this gene      Plasmid Map     
ACCN NM_000739
ORF Size 1398 bp
OTI Disclaimer The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Product Components The ORF clone is ion-exchange column purified and shipped in a 2D barcoded Matrix tube containing 10ug of transfection-ready, dried plasmid DNA (reconstitute with 100 ul of water).
Reconstitution 1. Centrifuge at 5,000xg for 5min.
2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA.
3. Close the tube and incubate for 10 minutes at room temperature.
4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom.
5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C.
Reference Data
RefSeq NM_000739.3
RefSeq Size 2530 bp
RefSeq ORF 1401 bp
Locus ID 1129
UniProt ID P08172
Cytogenetics 7q33
Protein Families Druggable Genome, GPCR, Transmembrane
Protein Pathways Calcium signaling pathway, Neuroactive ligand-receptor interaction, Regulation of actin cytoskeleton
MW 51.5 kDa
Gene Summary The muscarinic cholinergic receptors belong to a larger family of G protein-coupled receptors. The functional diversity of these receptors is defined by the binding of acetylcholine to these receptors and includes cellular responses such as adenylate cyclase inhibition, phosphoinositide degeneration, and potassium channel mediation. Muscarinic receptors influence many effects of acetylcholine in the central and peripheral nervous system. The muscarinic cholinergic receptor 2 is involved in mediation of bradycardia and a decrease in cardiac contractility. Multiple alternatively spliced transcript variants have been described for this gene. [provided by RefSeq, Jul 2008]

Other Versions

Other products for "CHRM2"
Frequently bought together (5)
Clone OTI4C5, Anti-DDK (FLAG) monoclonal antibody
    • 30 ul

USD 165.00


pCMV6-Entry, mammalian vector with C-terminal Myc- DDK Tag, 10ug
    • 10 ug

USD 627.00


DH5α Chemically Competent Cells (≥10^8 cfu/μg of pUC19 DNA)
    • 5 x 200 ul

USD 149.00


Forward sequencing primer VP1.5, Reverse sequencing primer XL39, 100pmoles each
    • 100 pmol

USD 55.00


Rabbit polyclonal anti-CHRM2 antibody
    • 100 ul

USD 380.00

Customer Reviews 
Loading...
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.