RON (MST1R) (NM_002447) Human Tagged ORF Clone

CAT#: RC212786

Reviews ()
Write a review

MST1R (Myc-DDK-tagged)-Human macrophage stimulating 1 receptor (c-met-related tyrosine kinase) (MST1R)



Reconstitution Protocol

USD 1,198.00

In Stock*

Size
    • 10 ug

Product images

Frequently bought together (4)
Clone OTI4C5, Anti-DDK (FLAG) monoclonal antibody
    • 30 ul

USD 177.00


pCMV6-Entry, mammalian vector with C-terminal Myc- DDK Tag, 10ug
    • 10 ug

USD 650.00


DH5α Chemically Competent Cells (≥10^8 cfu/μg of pUC19 DNA)
    • 5 x 200 ul

USD 160.00


Forward sequencing primer VP1.5, Reverse sequencing primer XL39, 100pmoles each
    • 100 pmol

USD 59.00

Other products for "MST1R"

Specifications

Product Data
Type Human Tagged ORF Clone
Tag Myc-DDK
Symbol MST1R
Synonyms CD136; CDw136; NPCA3; PTK8; RON; SEA
Vector pCMV6-Entry
E. coli Selection Kanamycin (25 ug/mL)
Mammalian Cell Selection Neomycin
Sequence Data
>RC212786 representing NM_002447
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGGAGCTCCTCCCGCCGCTGCCTCAGTCCTTCCTGTTGCTGCTGCTGTTGCCTGCCAAGCCCGCGGCGG
GCGAGGACTGGCAGTGCCCGCGCACCCCCTACGCGGCCTCTCGCGACTTTGACGTGAAGTACGTGGTGCC
CAGCTTCTCCGCCGGAGGCCTGGTACAGGCCATGGTGACCTACGAGGGCGACAGAAATGAGAGTGCTGTG
TTTGTAGCCATACGCAATCGCCTGCATGTGCTTGGGCCTGACCTGAAGTCTGTCCAGAGCCTGGCCACGG
GCCCTGCTGGAGACCCTGGCTGCCAGACGTGTGCAGCCTGTGGCCCAGGACCCCACGGCCCTCCCGGTGA
CACAGACACAAAGGTGCTGGTGCTGGATCCCGCGCTGCCTGCGCTGGTCAGTTGTGGCTCCAGCCTGCAG
GGCCGCTGCTTCCTGCATGACCTAGAGCCCCAAGGGACAGCCGTGCATCTGGCAGCGCCAGCCTGCCTCT
TCTCAGCCCACCATAACCGGCCCGATGACTGCCCCGACTGTGTGGCCAGCCCATTGGGCACCCGTGTAAC
TGTGGTTGAGCAAGGCCAGGCCTCCTATTTCTACGTGGCATCCTCACTGGACGCAGCCGTGGCTGCCAGC
TTCAGCCCACGCTCAGTGTCTATCAGGCGTCTCAAGGCTGACGCCTCGGGATTCGCACCGGGCTTTGTGG
CGTTGTCAGTGCTGCCCAAGCATCTTGTCTCCTACAGTATTGAATACGTGCACAGCTTCCACACGGGAGC
CTTCGTGTACTTCCTGACTGTACAGCCGGCCAGCGTGACAGATGATCCTAGTGCCCTGCACACACGCCTG
GCACGGCTTAGCGCCACTGAGCCAGAGTTGGGTGACTATCGGGAGCTGGTCCTCGACTGCAGATTTGCTC
CAAAACGCAGGCGCCGGGGGGCCCCAGAAGGCGGACAGCCCTACCCTGTGCTGCGGGTGGCCCACTCCGC
TCCAGTGGGTGCCCAACTTGCCACTGAGCTGAGCATCGCCGAGGGCCAGGAAGTACTATTTGGGGTCTTT
GTGACTGGCAAGGATGGTGGTCCTGGCGTGGGCCCCAACTCTGTCGTCTGTGCCTTCCCCATTGACCTGC
TGGACACACTAATTGATGAGGGTGTGGAGCGCTGTTGTGAATCCCCAGTCCATCCAGGCCTCCGGCGAGG
CCTCGACTTCTTCCAGTCGCCCAGTTTTTGCCCCAACCCGCCTGGCCTGGAAGCCCTCAGCCCCAACACC
AGCTGCCGCCACTTCCCTCTGCTGGTCAGTAGCAGCTTCTCACGTGTGGACCTATTCAATGGGCTGTTGG
GACCAGTACAGGTCACTGCATTGTATGTGACACGCCTTGACAACGTCACAGTGGCACACATGGGCACAAT
GGATGGGCGTATCCTGCAGGTGGAGCTGGTCAGGTCACTAAACTACTTGCTGTATGTGTCCAACTTCTCA
CTGGGTGACAGTGGGCAGCCCGTGCAGCGGGATGTCAGTCGTCTTGGGGACCACCTACTCTTTGCCTCTG
GGGACCAGGTTTTCCAGGTACCTATCCAAGGCCCTGGCTGCCGCCACTTCCTGACCTGTGGGCGTTGCCT
AAGGGCATGGCATTTCATGGGCTGTGGCTGGTGTGGGAACATGTGCGGCCAGCAGAAGGAGTGTCCTGGC
TCCTGGCAACAGGACCACTGCCCACCTAAGCTTACTGAGTTCCACCCCCACAGTGGACCTCTAAGGGGCA
GTACAAGGCTGACCCTGTGTGGCTCCAACTTCTACCTTCACCCTTCTGGTCTGGTGCCTGAGGGAACCCA
TCAGGTCACTGTGGGCCAAAGTCCCTGCCGGCCACTGCCCAAGGACAGCTCAAAACTCAGACCAGTGCCC
CGGAAAGACTTTGTAGAGGAGTTTGAGTGTGAACTGGAGCCCTTGGGCACCCAGGCAGTGGGGCCTACCA
ACGTCAGCCTCACCGTGACTAACATGCCACCGGGCAAGCACTTCCGGGTGGACGGCACCTCCGTGCTGAG
AGGCTTCTCTTTCATGGAGCCAGTGCTGATAGCAGTGCAACCCCTCTTTGGCCCACGGGCAGGAGGCACC
TGTCTCACTCTTGAAGGCCAGAGTCTGTCTGTAGGCACCAGCCGGGCTGTGCTGGTCAATGGGACTGAGT
GTCTGCTAGCACGGGTCAGTGAGGGGCAGCTTTTATGTGCCACACCCCCTGGGGCCACGGTGGCCAGTGT
CCCCCTTAGCCTGCAGGTGGGGGGTGCCCAGGTACCTGGTTCCTGGACCTTCCAGTACAGAGAAGACCCT
GTCGTGCTAAGCATCAGCCCCAACTGTGGCTACATCAACTCCCACATCACCATCTGTGGCCAGCATCTAA
CTTCAGCATGGCACTTAGTGCTGTCATTCCATGACGGGCTTAGGGCAGTGGAAAGCAGGCAGTGTGAGAG
GCAGCTTCCAGAGCAGCAGCTGTGCCGCCTTCCTGAATATGTGGTCCGAGACCCCCAGGGATGGGTGGCA
GGGAATCTGAGTGCCCGAGGGGATGGAGCTGCTGGCTTTACACTGCCTGGCTTTCGCTTCCTACCCCCAC
CCCATCCACCCAGTGCCAACCTAGTTCCACTGAAGCCTGAGGAGCATGCCATTAAGTTTGAGTATATTGG
GCTGGGCGCTGTGGCTGACTGTGTGGGTATCAACGTGACCGTGGGTGGTGAGAGCTGCCAGCACGAGTTC
CGGGGGGACATGGTTGTCTGCCCCCTGCCCCCATCCCTGCAGCTTGGCCAGGATGGTGCCCCATTGCAGG
TCTGCGTAGATGGTGAATGTCATATCCTGGGTAGAGTGGTGCGGCCAGGGCCAGATGGGGTCCCACAGAG
CACGCTCCTTGGTATCCTGCTGCCTTTGCTGCTGCTTGTGGCTGCACTGGCGACTGCACTGGTCTTCAGC
TACTGGTGGCGGAGGAAGCAGCTAGTTCTTCCTCCCAACCTGAATGACCTGGCATCCCTGGACCAGACTG
CTGGAGCCACACCCCTGCCTATTCTGTACTCGGGCTCTGACTACAGAAGTGGCCTTGCACTCCCTGCCAT
TGATGGTCTGGATTCCACCACTTGTGTCCATGGAGCATCCTTCTCCGATAGTGAAGATGAATCCTGTGTG
CCACTGCTGCGGAAAGAGTCCATCCAGCTAAGGGACCTGGACTCTGCGCTCTTGGCTGAGGTCAAGGATG
TGCTGATTCCCCATGAGCGGGTGGTCACCCACAGTGACCGAGTCATTGGCAAAGGCCACTTTGGAGTTGT
CTACCACGGAGAATACATAGACCAGGCCCAGAATCGAATCCAATGTGCCATCAAGTCACTAAGTCGCATC
ACAGAGATGCAGCAGGTGGAGGCCTTCCTGCGAGAGGGGCTGCTCATGCGTGGCCTGAACCACCCGAATG
TGCTGGCTCTCATTGGTATCATGTTGCCACCTGAGGGCCTGCCCCATGTGCTGCTGCCCTATATGTGCCA
CGGTGACCTGCTCCAGTTCATCCGCTCACCTCAGCGGAACCCCACCGTGAAGGACCTCATCAGCTTTGGC
CTGCAGGTAGCCCGCGGCATGGAGTACCTGGCAGAGCAGAAGTTTGTGCACAGGGACCTGGCTGCGCGGA
ACTGCATGCTGGACGAGTCATTCACAGTCAAGGTGGCTGACTTTGGTTTGGCCCGCGACATCCTGGACAG
GGAGTACTATAGTGTTCAACAGCATCGCCACGCTCGCCTACCTGTGAAGTGGATGGCGCTGGAGAGCCTG
CAGACCTATAGATTTACCACCAAGTCTGATGTGTGGTCATTTGGTGTGCTGCTGTGGGAACTGCTGACAC
GGGGTGCCCCACCATACCGCCACATTGACCCTTTTGACCTTACCCACTTCCTGGCCCAGGGTCGGCGCCT
GCCCCAGCCTGAGTATTGCCCTGATTCTCTGTACCAAGTGATGCAGCAATGCTGGGAGGCAGACCCAGCA
GTGCGACCCACCTTCAGAGTACTAGTGGGGGAGGTGGAGCAGATAGTGTCTGCACTGCTTGGGGACCATT
ATGTGCAGCTGCCAGCAACCTACATGAACTTGGGCCCCAGCACCTCGCATGAGATGAATGTGCGTCCAGA
ACAGCCGCAGTTCTCACCCATGCCAGGGAATGTACGCCGGCCCCGGCCACTCTCAGAGCCTCCTCGGCCC
ACT


ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT
ACAAGGATGACGACGATAAG
GTTTAA
>RC212786 representing NM_002447
Red=Cloning site Green=Tags(s)

MELLPPLPQSFLLLLLLPAKPAAGEDWQCPRTPYAASRDFDVKYVVPSFSAGGLVQAMVTYEGDRNESAV
FVAIRNRLHVLGPDLKSVQSLATGPAGDPGCQTCAACGPGPHGPPGDTDTKVLVLDPALPALVSCGSSLQ
GRCFLHDLEPQGTAVHLAAPACLFSAHHNRPDDCPDCVASPLGTRVTVVEQGQASYFYVASSLDAAVAAS
FSPRSVSIRRLKADASGFAPGFVALSVLPKHLVSYSIEYVHSFHTGAFVYFLTVQPASVTDDPSALHTRL
ARLSATEPELGDYRELVLDCRFAPKRRRRGAPEGGQPYPVLRVAHSAPVGAQLATELSIAEGQEVLFGVF
VTGKDGGPGVGPNSVVCAFPIDLLDTLIDEGVERCCESPVHPGLRRGLDFFQSPSFCPNPPGLEALSPNT
SCRHFPLLVSSSFSRVDLFNGLLGPVQVTALYVTRLDNVTVAHMGTMDGRILQVELVRSLNYLLYVSNFS
LGDSGQPVQRDVSRLGDHLLFASGDQVFQVPIQGPGCRHFLTCGRCLRAWHFMGCGWCGNMCGQQKECPG
SWQQDHCPPKLTEFHPHSGPLRGSTRLTLCGSNFYLHPSGLVPEGTHQVTVGQSPCRPLPKDSSKLRPVP
RKDFVEEFECELEPLGTQAVGPTNVSLTVTNMPPGKHFRVDGTSVLRGFSFMEPVLIAVQPLFGPRAGGT
CLTLEGQSLSVGTSRAVLVNGTECLLARVSEGQLLCATPPGATVASVPLSLQVGGAQVPGSWTFQYREDP
VVLSISPNCGYINSHITICGQHLTSAWHLVLSFHDGLRAVESRQCERQLPEQQLCRLPEYVVRDPQGWVA
GNLSARGDGAAGFTLPGFRFLPPPHPPSANLVPLKPEEHAIKFEYIGLGAVADCVGINVTVGGESCQHEF
RGDMVVCPLPPSLQLGQDGAPLQVCVDGECHILGRVVRPGPDGVPQSTLLGILLPLLLLVAALATALVFS
YWWRRKQLVLPPNLNDLASLDQTAGATPLPILYSGSDYRSGLALPAIDGLDSTTCVHGASFSDSEDESCV
PLLRKESIQLRDLDSALLAEVKDVLIPHERVVTHSDRVIGKGHFGVVYHGEYIDQAQNRIQCAIKSLSRI
TEMQQVEAFLREGLLMRGLNHPNVLALIGIMLPPEGLPHVLLPYMCHGDLLQFIRSPQRNPTVKDLISFG
LQVARGMEYLAEQKFVHRDLAARNCMLDESFTVKVADFGLARDILDREYYSVQQHRHARLPVKWMALESL
QTYRFTTKSDVWSFGVLLWELLTRGAPPYRHIDPFDLTHFLAQGRRLPQPEYCPDSLYQVMQQCWEADPA
VRPTFRVLVGEVEQIVSALLGDHYVQLPATYMNLGPSTSHEMNVRPEQPQFSPMPGNVRRPRPLSEPPRP
T

myc-FLAG tag
Chromatograms CHROMATOGRAMS
Sequencher program is needed, download here.
Restriction Sites SgfI-MluI      Cloning Scheme for this gene      Plasmid Map     
ACCN NM_002447
ORF Size 4203 bp
OTI Disclaimer The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Product Components The ORF clone is ion-exchange column purified and shipped in a 2D barcoded Matrix tube containing 10ug of transfection-ready, dried plasmid DNA (reconstitute with 100 ul of water).
Reconstitution 1. Centrifuge at 5,000xg for 5min.
2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA.
3. Close the tube and incubate for 10 minutes at room temperature.
4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom.
5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C.
Reference Data
RefSeq NM_002447.4
RefSeq Size 4541 bp
RefSeq ORF 4203 bp
Locus ID 4486
UniProt ID Q04912
Cytogenetics 3p21.31
Protein Families Druggable Genome, ES Cell Differentiation/IPS, Protein Kinase, Transmembrane
MW 152.37 kDa
Gene Summary This gene encodes a cell surface receptor for macrophage-stimulating protein (MSP) with tyrosine kinase activity. The mature form of this protein is a heterodimer of disulfide-linked alpha and beta subunits, generated by proteolytic cleavage of a single-chain precursor. The beta subunit undergoes tyrosine phosphorylation upon stimulation by MSP. This protein is expressed on the ciliated epithelia of the mucociliary transport apparatus of the lung, and together with MSP, thought to be involved in host defense. Alternative splicing generates multiple transcript variants encoding different isoforms that may undergo similar proteolytic processing. [provided by RefSeq, Jan 2016]
Customer Reviews 
Loading...
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.