FIGLA (NM_001004311) Human Tagged ORF Clone

CAT#: RC212562

FIGLA (Myc-DDK-tagged)-Human folliculogenesis specific basic helix-loop-helix (FIGLA)

Clone Modification / Custom Cloning Service

USD 98.00

USD 390.00


Availability*
In Stock

Size
    • 10 ug

Product images

Specifications

Product Data
Product Name FIGLA (NM_001004311) Human Tagged ORF Clone
Symbol FIGLA
Synonyms BHLHC8; FIGALPHA; POF6
Vector pCMV6-Entry
Sequence Data
ORF Nucleotide Sequence
>RC212562 representing NM_001004311
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGGACCCCGCGCCCGGCGTCCTAGATCCCCGCGCCGCGCCGCCCGCGCTCCTGGGCACCCCGCAAGCCG
AGGTGCTGGAGGACGTGTTGCGGGAGCAGTTCGGGCCGCTGCCCCAGCTGGCCGCTGTCTGCCGGCTCAA
GCGGCTGCCCTCGGGCGGCTACTCGTCCACTGAAAACCTCCAGTTGGTGCTGGAGCGGCGGCGTGTGGCC
AACGCCAAGGAGCGTGAGCGGATAAAAAATCTCAACCGTGGTTTTGCCAGATTGAAGGCACTTGTGCCAT
TTCTTCCCCAAAGCAGGAAGCCCAGCAAAGTTGATATCCTTAAAGGTGCGACTGAATATATACAGGTTCT
CAGTGATCTTTTGGAAGGAGCCAAAGACTCAAAGAAACAAGACCCAGATGAGCAGAGCTATAGTAACAAC
AGTTCTGAATCACATACATCCTCGGCAAGACAGCTGTCAAGAAACATCACCCAACATATCAGCTGTGCTT
TCGGCTTGAAGAATGAAGAGGAAGGGCCTTGGGCAGATGGTGGCAGTGGTGAGCCAGCACACGCTTGTCG
CCACAGTGTGATGTCTACGACTGAAATTATCTCCCCAACCAGAAGTCTGGATAGATTCCCAGAAGTAGAA
CTGCTGAGTCACAGACTTCCACAAGTA


ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT
ACAAGGATGACGACGATAAG
GTTTAA
Protein Sequence
>RC212562 representing NM_001004311
Red=Cloning site Green=Tags(s)

MDPAPGVLDPRAAPPALLGTPQAEVLEDVLREQFGPLPQLAAVCRLKRLPSGGYSSTENLQLVLERRRVA
NAKERERIKNLNRGFARLKALVPFLPQSRKPSKVDILKGATEYIQVLSDLLEGAKDSKKQDPDEQSYSNN
SSESHTSSARQLSRNITQHISCAFGLKNEEEGPWADGGSGEPAHACRHSVMSTTEIISPTRSLDRFPEVE
LLSHRLPQV

myc-FLAG tag
Chromatograms CHROMATOGRAMS
Sequencher program is needed, download here.
Restriction Sites SgfI-MluI      Cloning Scheme for this gene      Plasmid Map     
Tag Myc-DDK
ACCN NM_001004311
ORF Size 657 bp
OTI Disclaimer The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Product Components The ORF clone is ion-exchange column purified, transfection-ready dried plasmid DNA, and shipped with 2 vector sequencing primers.
Reference Data
RefSeq NM_001004311.1, NM_001004311.2, NM_001004311.3, NP_001004311
RefSeq Size 724
RefSeq ORF 660
Locus ID 344018
Cytogenetics 2p13.3
MW 23.9 kDa
Gene Summary This gene encodes a protein that functions in postnatal oocyte-specific gene expression. The protein is a basic helix-loop-helix transcription factor that regulates multiple oocyte-specific genes, including genes involved in folliculogenesis and those that encode the zona pellucida. Mutations in this gene cause premature ovarian failure type 6. [provided by RefSeq, Sep 2009].
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Citations