FBXO44 (NM_001014765) Human Tagged ORF Clone

CAT#: RC212532

Reviews ()
Write a review

FBXO44 (Myc-DDK-tagged)-Human F-box protein 44 (FBXO44), transcript variant 4


  "NM_001014765" in other vectors (6)

USD 98.00

USD 390.00


Availability*
In Stock

Size
    • 10 ug


Product images

Specifications

Product Data
Product Name FBXO44 (NM_001014765) Human Tagged ORF Clone
Type Human Tagged ORF Clone
Tag Myc-DDK
Symbol FBXO44
Synonyms FBG3; FBX6A; FBX30; Fbx44; Fbxo6a
Vector pCMV6-Entry
E. coli Selection Kanamycin (25 ug/mL)
Cell Selection Neomycin
Sequence Data
>RC212532 representing NM_001014765
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGGCTGTGGGGAACATCAACGAGCTGCCCGAGAACATCCTGCTGGAGCTGTTCACGCACGTGCCCGCCC
GCCAGCTGCTGCTGAACTGCCGCCTGGTCTGCAGCCTCTGGCGGGACCTCATCGACCTCGTGACCCTCTG
GAAACGCAAGTGCCTGCGAGAGGGCTTCATCACTGAGGACTGGGACCAGCCCGTGGCCGACTGGAAGATC
TTCTACTTCTTACGGAGCCTGCACAGGAACCTCCTGCACAACCCGTGCGCTGAAGAGGGGTTCGAGTTCT
GGAGCCTGGATGTGAATGGAGGCGATGAGTGGAAGGTGGAGGATCTCTCTCGAGACCAGAGGAAGGAATT
CCCCAATGACCAGGTCAAGAAATACTTCGTTACTTCATATTACACCTGCCTCAAGTCCCAGGTGGTGGAC
CTCAAGGCCGAAGGGTATTGGGAGGAGCTGATGGATACCACACGGCCGGACATCGAGGTCAAGGACTGGT
TCGCAGCCAGGCCAGATTGCGGGTCCAAGTACCAGCTGTGCGTTCAGCTCCTGTCGTCCGCGCACGCGCC
TCTGGGGACCTTCCAGCCAGACCCGGCGACCATCCAGCAGAAGAGCGATGCCAAGTGGAGGGAGGTCTCC
CACACATTCTCCAACTACCCGCCCGGCGTCCGCTACATCTGGTTTCAGCACGGCGGCGTGGACACTCATT
ACTGGGCCGGCTGGTACGGCCCGAGGGTCACCAACAGCAGCATCACCATCGGGCCCCCGCTGCCC


ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT
ACAAGGATGACGACGATAAG
GTTTAA
>RC212532 representing NM_001014765
Red=Cloning site Green=Tags(s)

MAVGNINELPENILLELFTHVPARQLLLNCRLVCSLWRDLIDLVTLWKRKCLREGFITEDWDQPVADWKI
FYFLRSLHRNLLHNPCAEEGFEFWSLDVNGGDEWKVEDLSRDQRKEFPNDQVKKYFVTSYYTCLKSQVVD
LKAEGYWEELMDTTRPDIEVKDWFAARPDCGSKYQLCVQLLSSAHAPLGTFQPDPATIQQKSDAKWREVS
HTFSNYPPGVRYIWFQHGGVDTHYWAGWYGPRVTNSSITIGPPLP

myc-FLAG tag
Chromatograms CHROMATOGRAMS
Sequencher program is needed, download here.
Restriction Sites SgfI-MluI      Cloning Scheme for this gene      Plasmid Map     
Tag Myc-DDK
ACCN NM_001014765
ORF Size 765 bp
OTI Disclaimer The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Product Components The ORF clone is ion-exchange column purified, transfection-ready dried plasmid DNA, and shipped with 2 vector sequencing primers.
Reference Data
RefSeq NM_001014765.1, NP_001014765.1
RefSeq Size 3320
RefSeq ORF 768
Locus ID 93611
Cytogenetics 1p36.22
Protein Families Druggable Genome
MW 29.6 kDa
Gene Summary This gene encodes a member of the F-box protein family which is characterized by an approximately 40 amino acid motif, the F-box. The F-box proteins constitute one of the four subunits of the ubiquitin protein ligase complex called SCFs (SKP1-cullin-F-box), which function in phosphorylation-dependent ubiquitination. The F-box proteins are divided into 3 classes: Fbws containing WD-40 domains, Fbls containing leucine-rich repeats, and Fbxs containing either different protein-protein interaction modules or no recognizable motifs. The protein encoded by this gene belongs to the Fbxs class. It is also a member of the NFB42 (neural F Box 42 kDa) family, similar to F-box only protein 2 and F-box only protein 6. Several alternatively spliced transcript variants encoding two distinct isoforms have been found for this gene. [provided by RefSeq, Feb 2015]

Other Versions

Other products for "FBXO44"
Frequently bought together (3)
Clone OTI4C5, Anti-DDK (FLAG) monoclonal antibody
    • 100 ul

USD 310.00


pCMV6-Entry, mammalian vector with C-terminal Myc- DDK Tag, 10ug
    • 10 ug

USD 570.00


Rabbit Polyclonal Antibody against FBG3
    • 100 ug

USD 350.00

Customer Reviews 
Loading...
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.
68 Mouse Clones
Molbio tools