Filamin C(FLNC) (NM_001458) Human Tagged ORF Clone

CAT#: RC212462

FLNC (Myc-DDK-tagged)-Human filamin C, gamma (FLNC), transcript variant 1

Need custom modification / cloning service?
Get a free quote

USD 1,999.00


Availability*
In Stock

Size
    • 10 ug

Cited in 4 publications.

Product images

Specifications

Product Data
Product Name Filamin C(FLNC) (NM_001458) Human Tagged ORF Clone
Symbol FLNC
Synonyms ABP-280; ABP280A; ABPA; ABPL; FLN2; MFM5; MPD4
Vector pCMV6-Entry
Sequence Data
>RC212462 representing NM_001458
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGATGAACAACAGCGGCTACTCAGACGCCGGCCTCGGCCTGGGCGATGAGACAGACGAGATGCCGTCCA
CGGAGAAGGACCTGGCGGAGGACGCGCCGTGGAAGAAGATCCAGCAGAACACATTCACGCGCTGGTGCAA
TGAGCACCTCAAGTGCGTGGGCAAGCGCCTGACCGACCTGCAGCGCGACCTCAGCGACGGGCTCCGGCTC
ATCGCGCTGCTCGAGGTGCTCAGCCAGAAGCGCATGTACCGCAAGTTCCATCCGCGCCCCAACTTCCGCC
AAATGAAGCTGGAGAACGTGTCCGTGGCCCTCGAGTTCCTCGAGCGCGAGCACATCAAGCTCGTGTCCAT
AGACAGCAAGGCCATCGTGGATGGGAACCTGAAGCTGATCCTGGGCCTGATCTGGACGCTGATCCTGCAC
TACTCCATCTCCATGCCCATGTGGGAGGATGAAGATGATGAGGATGCCCGCAAACAGACGCCCAAGCAGC
GGCTGCTTGGCTGGATCCAGAACAAGGTGCCCCAGCTGCCCATCACCAACTTCAACCGTGACTGGCAGGA
CGGCAAAGCTCTGGGCGCCCTGGTGGACAACTGCGCCCCCGGTCTCTGCCCCGACTGGGAGGCCTGGGAC
CCCAACCAGCCCGTGGAGAACGCCCGGGAGGCCATGCAGCAGGCCGACGACTGGCTTGGGGTGCCCCAGG
TCATTGCCCCTGAGGAGATTGTGGACCCCAACGTGGATGAGCATTCTGTTATGACCTACCTGTCCCAGTT
CCCCAAGGCCAAGCTCAAACCTGGTGCCCCTGTTCGATCCAAGCAGCTGAACCCCAAGAAAGCCATCGCC
TATGGGCCTGGCATCGAGCCACAGGGCAACACCGTGCTGCAGCCTGCCCACTTCACCGTGCAGACGGTGG
ACGCGGGCGTGGGCGAGGTGCTGGTCTACATCGAGGACCCTGAAGGCCACACCGAGGAGGCTAAGGTGGT
TCCCAACAATGACAAGGATCGCACCTATGCTGTCTCCTATGTGCCCAAGGTCGCTGGGTTACACAAGGTG
ACCGTGCTCTTTGCTGGCCAGAACATTGAACGCAGTCCCTTTGAGGTGAACGTGGGCATGGCCCTGGGAG
ATGCCAACAAGGTGTCAGCCCGTGGCCCTGGCCTGGAACCTGTGGGCAATGTGGCCAACAAACCCACCTA
CTTTGACATCTACACTGCGGGGGCCGGCACTGGCGATGTTGCTGTGGTGATCGTGGACCCACAGGGCCGG
CGGGACACAGTGGAGGTGGCCCTGGAGGACAAGGGTGACAGCACGTTCCGCTGCACATACAGACCTGCCA
TGGAGGGGCCACATACCGTGCATGTGGCCTTTGCGGGTGCCCCCATCACCCGCAGTCCCTTCCCTGTCCA
TGTGTCGGAAGCCTGTAACCCCAACGCCTGCCGCGCCTCTGGGCGAGGCCTGCAGCCCAAGGGTGTTCGC
GTGAAAGAGGTGGCTGACTTCAAGGTGTTTACCAAGGGTGCCGGCAGCGGGGAGCTCAAGGTCACGGTCA
AGGGGCCAAAGGGCACAGAGGAGCCAGTGAAGGTGCGGGAGGCTGGGGATGGTGTGTTCGAGTGCGAGTA
CTACCCGGTGGTGCCTGGGAAGTATGTGGTGACCATCACGTGGGGCGGCTACGCCATCCCTCGCAGCCCC
TTTGAGGTACAGGTGAGCCCAGAGGCAGGAGTGCAAAAGGTCCGGGCCTGGGGTCCTGGTTTGGAGACTG
GCCAGGTGGGCAAGTCAGCCGATTTTGTGGTGGAAGCCATTGGCACCGAGGTGGGGACACTGGGCTTCTC
CATCGAGGGGCCCTCACAAGCCAAGATCGAATGTGACGACAAGGGGGATGGCTCCTGCGATGTGCGGTAC
TGGCCCACGGAGCCTGGGGAGTACGCTGTGCACGTCATCTGTGACGATGAGGACATCCGAGACTCACCCT
TCATTGCCCACATCCTGCCCGCCCCACCTGACTGCTTCCCAGATAAGGTGAAGGCCTTTGGGCCTGGCCT
GGAGCCTACCGGCTGCATCGTGGACAAGCCCGCTGAGTTCACCATTGATGCTCGTGCAGCTGGCAAGGGA
GACCTGAAGCTCTATGCCCAGGACGCCGACGGCTGTCCCATCGACATCAAGGTGATCCCCAACGGCGACG
GCACCTTCCGCTGCTCCTACGTGCCCACCAAGCCCATTAAGCACACCATCATCATCTCCTGGGGAGGCGT
AAACGTGCCCAAGAGCCCCTTCCGGGTGAACGTGGGCGAGGGCAGCCACCCCGAGCGGGTAAAGGTGTAC
GGCCCCGGAGTGGAGAAGACAGGCCTCAAGGCCAATGAGCCCACCTACTTCACGGTGGACTGCAGCGAGG
CGGGGCAAGGCGACGTGAGCATCGGCATCAAGTGCGCCCCAGGCGTGGTGGGCCCTGCAGAGGCTGACAT
TGACTTCGACATCATCAAGAATGACAACGACACCTTCACCGTCAAGTACACGCCACCAGGGGCGGGCCGC
TACACCATCATGGTGCTGTTTGCCAACCAGGAGATCCCCGCCAGCCCCTTCCACATCAAGGTGGACCCAT
CCCACGATGCCAGCAAAGTCAAGGCCGAGGGCCCTGGGCTGAATCGCACAGGTGTGGAAGTCGGGAAGCC
CACCCACTTCACGGTGCTGACCAAGGGAGCCGGCAAGGCCAAGCTGGATGTGCAGTTTGCAGGGACAGCC
AAGGGCGAGGTTGTGCGGGACTTTGAGATCATAGACAACCATGACTACTCCTACACTGTCAAGTACACCG
CTGTCCAGCAGGGCAACATGGCAGTGACAGTGACTTATGGCGGGGACCCTGTCCCCAAGAGCCCCTTTGT
GGTGAATGTGGCACCCCCGCTGGACCTCAGCAAAATCAAAGTTCAGGGCCTTAATAGCAAGGTGGCTGTG
GGACAGGAACAAGCATTCTCTGTGAACACACGAGGGGCTGGCGGTCAGGGCCAACTGGATGTGCGGATGA
CTTCGCCCTCTCGCCGGCCCATCCCCTGCAAGCTGGAGCCAGGCGGTGGAGCGGAAGCCCAGGCTGTGCG
CTACATGCCCCCGGAGGAGGGGCCCTACAAGGTGGATATCACCTACGATGGTCACCCGGTGCCTGGCAGC
CCGTTTGCTGTGGAGGGTGTCCTGCCCCCTGATCCCTCCAAGGTCTGTGCTTATGGCCCGGGTCTCAAGG
GTGGACTGGTAGGCACCCCCGCGCCATTCTCCATCGACACCAAGGGGGCTGGCACAGGTGGCCTGGGGCT
GACCGTAGAGGGCCCCTGCGAGGCCAAGATCGAGTGCCAGGACAATGGTGATGGCTCATGTGCTGTCAGC
TACCTGCCCACGGAGCCTGGCGAGTACACCATCAACATCCTGTTTGCTGAGGCCCACATCCCTGGCTCGC
CCTTCAAAGCCACCATTCGGCCTGTGTTTGACCCGAGCAAGGTGCGGGCCAGTGGACCGGGCCTGGAGCG
CGGCAAGGTCGGTGAGGCAGCCACCTTCACTGTGGACTGCTCAGAGGCAGGCGAGGCGGAGCTGACCATT
GAGATCCTGTCGGATGCCGGGGTCAAGGCCGAGGTGCTGATCCACAACAACGCGGATGGCACCTACCACA
TCACCTACAGCCCTGCCTTCCCTGGCACCTACACCATTACCATCAAGTATGGCGGGCATCCCGTGCCCAA
ATTCCCCACCCGTGTCCATGTGCAGCCTGCGGTCGATACCAGTGGCGTCAAGGTCTCAGGGCCTGGTGTT
GAGCCACACGGTGTCCTGCGGGAGGTGACCACTGAGTTCACTGTGGATGCAAGATCCCTAACAGCCACAG
GCGGCAACCACGTGACGGCTCGTGTGCTCAACCCCTCGGGGGCCAAGACAGACACCTATGTGACAGACAA
TGGGGACGGCACCTACCGAGTGCAGTACACCGCCTACGAGGAGGGCGTGCATCTGGTGGAGGTCCTGTAT
GATGAGGTCGCTGTGCCCAAGAGCCCCTTCCGAGTGGGCGTGACCGAGGGCTGTGATCCCACCCGCGTCC
GAGCCTTCGGGCCAGGCCTGGAGGGTGGCTTGGTCAACAAGGCCAACCGATTCACTGTGGAGACCAGGGG
AGCGGGCACCGGGGGCCTTGGCCTAGCCATCGAGGGTCCCTCGGAAGCCAAGATGTCCTGCAAGGACAAC
AAGGATGGTAGCTGCACCGTGGAGTACATCCCCTTCACTCCTGGAGACTATGACGTCAACATCACCTTCG
GGGGGCGGCCCATCCCAGGGAGCCCGTTCCGCGTGCCAGTGAAGGATGTGGTGGACCCTGGGAAGGTGAA
GTGCTCAGGGCCAGGGCTGGGGGCTGGTGTCAGGGCCCGGGTTCCTCAGACCTTCACAGTGGACTGCAGT
CAAGCTGGCCGGGCGCCCCTGCAGGTGGCTGTGCTGGGCCCCACAGGTGTGGCCGAGCCTGTGGAGGTGC
GGGACAATGGAGATGGCACCCACACTGTCCACTACACCCCAGCCACTGACGGGCCCTACACGGTAGCCGT
CAAGTATGCTGACCAGGAGGTGCCACGCAGCCCCTTCAAGATCAAGGTCCTCCCAGCTCATGATGCCAGC
AAGGTGCGGGCCAGCGGCCCAGGCCTCAACGCCTCTGGCATCCCTGCCAGCCTGCCTGTGGAGTTCACCA
TCGACGCACGGGACGCGGGCGAGGGGTTGCTCACTGTCCAGATCTTGGACCCCGAGGGTAAGCCCAAGAA
GGCCAACATCCGGGACAATGGGGATGGCACGTACACTGTGTCCTACCTGCCGGACATGAGTGGCCGGTAC
ACCATCACCATCAAGTATGGCGGTGATGAGATCCCCTACTCGCCCTTCCGCATCCATGCTCTGCCCACTG
GGGATGCCAGCAAGTGCCTCGTCACAGTGTCCATTGGAGGCCATGGCCTGGGTGCCTGCCTGGGCCCTCG
AATCCAGATTGGGCAGGAGACGGTGATCACGGTGGATGCCAAGGCAGCCGGTGAGGGGAAGGTGACATGC
ACGGTGTCCACGCCGGATGGGGCAGAGCTCGATGTGGATGTGGTTGAGAACCATGACGGTACCTTTGACA
TCTACTACACAGCGCCCGAGCCGGGCAAGTACGTCATCACCATCCGCTTCGGGGGTGAGCACATCCCCAA
CAGCCCCTTCCACGTGCTGGCGTGTGACCCCCTGCCGCACGAGGAGGAGCCCTCTGAAGTGCCACAGCTG
CGCCAGCCCTACGCTCCTCCCCGGCCCGGCGCCCGCCCCACACACTGGGCCACAGAGGAGCCAGTGGTGC
CTGTGGAGCCAATGGAGTCCATGCTGAGGCCCTTCAACCTGGTCATCCCCTTCGCGGTGCAGAAAGGGGA
GCTCACAGGAGAGGTGCGGATGCCCTCGGGGAAGACGGCACGGCCCAACATCACCGACAACAAGGACGGC
ACCATCACGGTGAGGTATGCACCCACTGAGAAAGGCCTGCACCAGATGGGGATCAAGTATGACGGCAACC
ACATCCCTGGGAGCCCCTTACAGTTCTATGTGGATGCCATCAACAGCCGCCATGTCAGTGCCTATGGGCC
AGGCCTGAGCCATGGCATGGTCAACAAGCCAGCCACCTTCACTATTGTCACCAAAGATGCTGGAGAAGGG
GGTCTGTCACTGGCCGTGGAGGGCCCATCCAAGGCAGAGATCACCTGTAAGGACAACAAGGATGGCACCT
GCACCGTGTCCTATCTGCCGACTGCGCCTGGAGACTACAGCATCATCGTGCGCTTCGATGACAAGCACAT
CCCGGGGAGCCCCTTCACAGCCAAGATCACAGGTGATGACTCCATGAGGACCTCACAGCTGAATGTGGGC
ACCTCCACGGACGTGTCACTGAAGATCACCGAGAGTGATCTGAGCCAGCTGACCGCCAGCATCCGTGCCC
CCTCGGGCAACGAGGAGCCCTGCCTGCTGAAGCGCCTGCCCAACCGGCACATTGGGATCTCCTTCACCCC
CAAGGAGGTCGGGGAGCACGTGGTGAGCGTGCGCAAGAGTGGCAAGCATGTCACCAACAGCCCCTTCAAG
ATCCTGGTGGGGCCATCTGAGATCGGGGACGCCAGCAAGGTGCGGGTCTGGGGCAAGGGGCTTTCCGAGG
GACACACATTCCAGGTGGCAGAGTTCATCGTGGACACTCGCAATGCAGGTTATGGGGGCTTGGGGCTGAG
TATTGAAGGCCCAAGCAAGGTGGACATCAACTGTGAGGACATGGAGGACGGGACATGCAAAGTCACCTAC
TGCCCCACCGAGCCCGGCACCTACATCATCAACATCAAGTTTGCTGACAAGCACGTGCCTGGAAGCCCCT
TCACTGTGAAGGTGACCGGCGAGGGCCGCATGAAGGAGAGCATCACCCGGCGGAGACAGGCACCTTCCAT
CGCCACCATCGGCAGCACCTGTGACCTCAACCTCAAGATCCCAGGAAACTGGTTCCAGATGGTGTCTGCC
CAGGAGCGCCTGACACGCACCTTCACACGCAGCAGCCACACCTACACCCGCACGGAGCGCACGGAGATCA
GCAAGACGCGGGGCGGGGAGACAAAGCGCGAGGTGCGGGTGGAGGAGTCCACCCAGGTCGGCGGGGACCC
CTTCCCTGCTGTGTTTGGGGACTTCCTGGGCCGGGAGCGCCTGGGATCCTTCGGCAGCATCACCCGGCAG
CAGGAGGGTGAGGCCAGCTCTCAGGACATGACTGCACAGGTGACCAGCCCATCGGGCAAGGTGGAAGCCG
CAGAGATCGTCGAGGGCGAGGACAGCGCCTACAGCGTGCGCTTTGTGCCCCAGGAAATGGGGCCCCATAC
GGTCGCTGTCAAGTACCGTGGCCAGCACGTGCCCGGCAGCCCCTTTCAGTTCACTGTGGGGCCGCTGGGT
GAAGGTGGTGCCCACAAGGTGCGGGCCGGAGGCACAGGGCTGGAGCGAGGTGTGGCCGGCGTGCCAGCCG
AGTTCAGCATCTGGACCCGGGAGGCTGGCGCTGGGGGCCTGTCCATTGCTGTGGAGGGTCCTAGCAAAGC
GGAGATTGCATTTGAGGATCGCAAAGATGGCTCCTGCGGCGTCTCCTATGTCGTCCAGGAACCAGGTGAC
TATGAGGTCTCCATCAAGTTCAATGATGAGCACATCCCAGACAGCCCCTTTGTGGTGCCTGTGGCCTCCC
TCTCGGATGACGCTCGCCGTCTCACTGTCACCAGCCTCCAGGAGACGGGGCTCAAGGTGAACCAGCCAGC
GTCCTTTGCCGTGCAGCTGAACGGTGCCCGGGGCGTGATTGATGCCCGGGTGCACACACCCTCGGGGGCT
GTGGAGGAGTGCTACGTCTCTGAGCTGGACAGTGACAAGCACACCATCCGCTTCATCCCCCACGAGAATG
GCGTCCACTCCATCGATGTCAAGTTCAACGGTGCCCACATCCCTGGAAGTCCCTTCAAGATCCGCGTTGG
GGAGCAGAGCCAGGCTGGGGACCCAGGCTTGGTGTCAGCCTACGGTCCTGGGCTCGAGGGAGGCACTACC
GGTGTGTCATCAGAGTTCATCGTGAACACCCTGAATGCCGGCTCGGGGGCCTTGTCTGTCACCATTGATG
GCCCCTCCAAGGTGCAGCTGGACTGTCGGGAGTGTCCTGAGGGCCATGTGGTCACTTATACTCCCATGGC
CCCTGGCAACTACCTCATTGCCATCAAGTACGGTGGCCCCCAGCACATCGTGGGCAGCCCCTTCAAGGCC
AAGGTCACTGGTCCGAGGCTGTCCGGAGGCCACAGCCTTCACGAAACATCCACGGTTCTGGTGGAGACTG
TGACCAAGTCCTCCTCAAGCCGGGGCTCCAGCTACAGCTCCATCCCCAAGTTCTCCTCAGATGCCAGCAA
GGTGGTGACTCGGGGCCCTGGGCTGTCCCAGGCCTTCGTGGGCCAGAAGAACTCCTTCACCGTGGACTGC
AGCAAAGCAGGCACCAACATGATGATGGTGGGCGTGCACGGCCCCAAGACCCCCTGTGAGGAGGTGTACG
TGAAGCACATGGGGAACCGGGTGTACAATGTCACCTACACTGTCAAGGAGAAAGGGGACTACATCCTCAT
TGTCAAGTGGGGTGACGAAAGTGTCCCTGGAAGCCCCTTCAAAGTCAAGGTCCCT


ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT
ACAAGGATGACGACGATAAG
GTTTAA
>RC212462 representing NM_001458
Red=Cloning site Green=Tags(s)

MMNNSGYSDAGLGLGDETDEMPSTEKDLAEDAPWKKIQQNTFTRWCNEHLKCVGKRLTDLQRDLSDGLRL
IALLEVLSQKRMYRKFHPRPNFRQMKLENVSVALEFLEREHIKLVSIDSKAIVDGNLKLILGLIWTLILH
YSISMPMWEDEDDEDARKQTPKQRLLGWIQNKVPQLPITNFNRDWQDGKALGALVDNCAPGLCPDWEAWD
PNQPVENAREAMQQADDWLGVPQVIAPEEIVDPNVDEHSVMTYLSQFPKAKLKPGAPVRSKQLNPKKAIA
YGPGIEPQGNTVLQPAHFTVQTVDAGVGEVLVYIEDPEGHTEEAKVVPNNDKDRTYAVSYVPKVAGLHKV
TVLFAGQNIERSPFEVNVGMALGDANKVSARGPGLEPVGNVANKPTYFDIYTAGAGTGDVAVVIVDPQGR
RDTVEVALEDKGDSTFRCTYRPAMEGPHTVHVAFAGAPITRSPFPVHVSEACNPNACRASGRGLQPKGVR
VKEVADFKVFTKGAGSGELKVTVKGPKGTEEPVKVREAGDGVFECEYYPVVPGKYVVTITWGGYAIPRSP
FEVQVSPEAGVQKVRAWGPGLETGQVGKSADFVVEAIGTEVGTLGFSIEGPSQAKIECDDKGDGSCDVRY
WPTEPGEYAVHVICDDEDIRDSPFIAHILPAPPDCFPDKVKAFGPGLEPTGCIVDKPAEFTIDARAAGKG
DLKLYAQDADGCPIDIKVIPNGDGTFRCSYVPTKPIKHTIIISWGGVNVPKSPFRVNVGEGSHPERVKVY
GPGVEKTGLKANEPTYFTVDCSEAGQGDVSIGIKCAPGVVGPAEADIDFDIIKNDNDTFTVKYTPPGAGR
YTIMVLFANQEIPASPFHIKVDPSHDASKVKAEGPGLNRTGVEVGKPTHFTVLTKGAGKAKLDVQFAGTA
KGEVVRDFEIIDNHDYSYTVKYTAVQQGNMAVTVTYGGDPVPKSPFVVNVAPPLDLSKIKVQGLNSKVAV
GQEQAFSVNTRGAGGQGQLDVRMTSPSRRPIPCKLEPGGGAEAQAVRYMPPEEGPYKVDITYDGHPVPGS
PFAVEGVLPPDPSKVCAYGPGLKGGLVGTPAPFSIDTKGAGTGGLGLTVEGPCEAKIECQDNGDGSCAVS
YLPTEPGEYTINILFAEAHIPGSPFKATIRPVFDPSKVRASGPGLERGKVGEAATFTVDCSEAGEAELTI
EILSDAGVKAEVLIHNNADGTYHITYSPAFPGTYTITIKYGGHPVPKFPTRVHVQPAVDTSGVKVSGPGV
EPHGVLREVTTEFTVDARSLTATGGNHVTARVLNPSGAKTDTYVTDNGDGTYRVQYTAYEEGVHLVEVLY
DEVAVPKSPFRVGVTEGCDPTRVRAFGPGLEGGLVNKANRFTVETRGAGTGGLGLAIEGPSEAKMSCKDN
KDGSCTVEYIPFTPGDYDVNITFGGRPIPGSPFRVPVKDVVDPGKVKCSGPGLGAGVRARVPQTFTVDCS
QAGRAPLQVAVLGPTGVAEPVEVRDNGDGTHTVHYTPATDGPYTVAVKYADQEVPRSPFKIKVLPAHDAS
KVRASGPGLNASGIPASLPVEFTIDARDAGEGLLTVQILDPEGKPKKANIRDNGDGTYTVSYLPDMSGRY
TITIKYGGDEIPYSPFRIHALPTGDASKCLVTVSIGGHGLGACLGPRIQIGQETVITVDAKAAGEGKVTC
TVSTPDGAELDVDVVENHDGTFDIYYTAPEPGKYVITIRFGGEHIPNSPFHVLACDPLPHEEEPSEVPQL
RQPYAPPRPGARPTHWATEEPVVPVEPMESMLRPFNLVIPFAVQKGELTGEVRMPSGKTARPNITDNKDG
TITVRYAPTEKGLHQMGIKYDGNHIPGSPLQFYVDAINSRHVSAYGPGLSHGMVNKPATFTIVTKDAGEG
GLSLAVEGPSKAEITCKDNKDGTCTVSYLPTAPGDYSIIVRFDDKHIPGSPFTAKITGDDSMRTSQLNVG
TSTDVSLKITESDLSQLTASIRAPSGNEEPCLLKRLPNRHIGISFTPKEVGEHVVSVRKSGKHVTNSPFK
ILVGPSEIGDASKVRVWGKGLSEGHTFQVAEFIVDTRNAGYGGLGLSIEGPSKVDINCEDMEDGTCKVTY
CPTEPGTYIINIKFADKHVPGSPFTVKVTGEGRMKESITRRRQAPSIATIGSTCDLNLKIPGNWFQMVSA
QERLTRTFTRSSHTYTRTERTEISKTRGGETKREVRVEESTQVGGDPFPAVFGDFLGRERLGSFGSITRQ
QEGEASSQDMTAQVTSPSGKVEAAEIVEGEDSAYSVRFVPQEMGPHTVAVKYRGQHVPGSPFQFTVGPLG
EGGAHKVRAGGTGLERGVAGVPAEFSIWTREAGAGGLSIAVEGPSKAEIAFEDRKDGSCGVSYVVQEPGD
YEVSIKFNDEHIPDSPFVVPVASLSDDARRLTVTSLQETGLKVNQPASFAVQLNGARGVIDARVHTPSGA
VEECYVSELDSDKHTIRFIPHENGVHSIDVKFNGAHIPGSPFKIRVGEQSQAGDPGLVSAYGPGLEGGTT
GVSSEFIVNTLNAGSGALSVTIDGPSKVQLDCRECPEGHVVTYTPMAPGNYLIAIKYGGPQHIVGSPFKA
KVTGPRLSGGHSLHETSTVLVETVTKSSSSRGSSYSSIPKFSSDASKVVTRGPGLSQAFVGQKNSFTVDC
SKAGTNMMMVGVHGPKTPCEEVYVKHMGNRVYNVTYTVKEKGDYILIVKWGDESVPGSPFKVKVP

myc-FLAG tag
Chromatograms CHROMATOGRAMS
Sequencher program is needed, download here.
Restriction Sites SgfI-MluI      Cloning Scheme for this gene      Plasmid Map     
Tag Myc-DDK
ACCN NM_001458
ORF Size 8175 bp
OTI Disclaimer Due to the inherent nature of this plasmid, standard methods to replicate additional amounts of DNA in E. coli are highly likely to result in mutations and/or rearrangements. Therefore, OriGene does not guarantee the capability to replicate this plasmid DNA. Additional amounts of DNA can be purchased from OriGene with batch-specific, full-sequence verification at a reduced cost. Please contact our customer care team at custsupport@origene.com or by calling 301.340.3188 option 3 for pricing and delivery.

The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Product Components The ORF clone is ion-exchange column purified, transfection-ready dried plasmid DNA, and shipped with 2 vector sequencing primers.
Reference Data
RefSeq NM_001458.3, NM_001458.4, NP_001449
RefSeq Size 9146
RefSeq ORF 8178
Locus ID 2318
Cytogenetics 7q32.1
Protein Pathways MAPK signaling pathway, Focal adhesion
MW 290.8 kDa
Gene Summary This gene encodes one of three related filamin genes, specifically gamma filamin. These filamin proteins crosslink actin filaments into orthogonal networks in cortical cytoplasm and participate in the anchoring of membrane proteins for the actin cytoskeleton. Three functional domains exist in filamin: an N-terminal filamentous actin-binding domain, a C-terminal self-association domain, and a membrane glycoprotein-binding domain. Two transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq, Jul 2008].
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Citations (4)