PYGM (NM_005609) Human Tagged ORF Clone

CAT#: RC212365

Reviews ()
Write a review

PYGM (Myc-DDK-tagged)-Human phosphorylase, glycogen, muscle (PYGM), transcript variant 1

  View "NM_005609" in other vectors (10)

USD 420.00


Availability*
In Stock

Size
    • 10 ug


Product images

Specifications

Product Data
Product Name PYGM (NM_005609) Human Tagged ORF Clone
Type Human Tagged ORF Clone
Tag Myc-DDK
Symbol PYGM
Synonyms glycogen phosphorylase; glycogen storage disease type V; McArdle syndrome; muscle (McArdle syndrome, glycogen storage disease type V); myophosphorylase; phosphorylase, glycogen; phosphorylase, glycogen, muscle
Vector pCMV6-Entry
E. coli Selection Kanamycin (25 ug/mL)
Cell Selection Neomycin
Sequence Data
>RC212365 representing NM_005609
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGTCCCGGCCCCTGTCAGACCAAGAGAAAAGAAAGCAAATCAGTGTGCGTGGCCTGGCCGGCGTGGAGA
ACGTGACTGAGCTGAAAAAGAACTTCAACCGGCACCTGCATTTCACACTCGTAAAGGACCGCAATGTGGC
CACCCCACGAGACTACTACTTTGCTCTGGCCCATACCGTGCGCGACCACCTCGTGGGGCGCTGGATCCGC
ACGCAGCAGCACTACTATGAGAAGGACCCCAAGAGGATCTACTACCTGTCTTTAGAGTTCTATATGGGAC
GGACGCTACAGAACACCATGGTGAACCTGGCCTTAGAGAATGCCTGTGACGAGGCCACCTACCAGCTGGG
CCTGGACATGGAGGAGCTGGAGGAAATTGAGGAGGATGCGGGGCTGGGCAACGGGGGCCTGGGCCGGCTG
GCAGCCTGCTTTCTTGACTCCATGGCAACACTGGGCCTGGCCGCCTATGGCTACGGGATTCGCTATGAGT
TTGGGATTTTTAACCAGAAGATCTCCGGGGGCTGGCAGATGGAGGAGGCCGATGACTGGCTTCGCTACGG
CAACCCCTGGGAGAAGGCCCGGCCCGAGTTCACGCTACCTGTGCACTTCTACGGCCATGTGGAGCACACC
AGCCAGGGTGCCAAGTGGGTGGACACACAGGTGGTACTGGCCATGCCCTACGATACGCCCGTGCCTGGCT
ATCGCAACAATGTTGTCAACACCATGCGCCTCTGGTCTGCCAAGGCTCCCAATGACTTCAACCTCAAGGA
CTTCAATGTCGGTGGCTACATCCAGGCTGTGTTGGACCGAAACCTGGCGGAGAACATCTCTCGTGTCCTG
TACCCCAATGATAATTTCTTCGAAGGGAAGGAGCTGCGGCTGAAGCAGGAGTATTTCGTGGTGGCTGCCA
CCCTCCAGGACATCATCCGTCGCTTCAAGTCTTCCAAGTTCGGCTGCCGTGATCCCGTGCGCACGAACTT
CGATGCCTTCCCAGATAAGGTGGCCATCCAGCTCAATGACACCCACCCCTCCCTGGCCATCCCCGAGCTG
ATGAGGATCCTGGTGGACCTGGAACGGATGGACTGGGACAAGGCGTGGGATGTGACAGTGAGGACCTGTG
CCTACACCAACCACACGGTGCTGCCCGAGGCCCTGGAGCGCTGGCCGGTGCACCTCTTGGAGACGCTGCT
GCCGCGGCACCTCCAGATCATCTACGAGATCAACCAGCGCTTCCTCAACCGGGTGGCGGCCGCATTCCCA
GGGGACGTAGACCGGCTGCGGCGCATGTCGCTGGTGGAGGAGGGCGCAGTGAAGCGCATCAACATGGCAC
ACCTGTGCATCGCGGGGTCGCACGCCGTCAACGGCGTGGCGCGCATCCACTCCGAGATCCTCAAGAAGAC
CATCTTCAAAGACTTCTATGAGCTGGAGCCTCATAAGTTCCAGAATAAGACCAACGGCATCACCCCTCGG
CGCTGGCTGGTTCTGTGTAACCCCGGGCTGGCAGAGGTCATTGCTGAGCGCATCGGGGAGGACTTCATCT
CTGACCTGGACCAGCTGCGCAAACTGCTCTCCTTTGTGGATGATGAAGCTTTCATTCGGGATGTGGCCAA
AGTGAAGCAGGAAAACAAGTTGAAGTTTGCTGCCTACCTAGAGAGGGAATACAAAGTCCACATCAACCCC
AACTCACTCTTCGACATCCAGGTGAAGCGGATTCACGAATATAAACGACAGCTCCTCAACTGCCTCCATG
TCATCACCCTGTACAACCGCATCAAGAGGGAGCCCAATAAGTTTTTTGTGCCTCGGACTGTGATGATTGG
AGGGAAGGCTGCACCTGGGTACCACATGGCCAAGATGATCATCAGACTCGTCACAGCCATCGGGGATGTG
GTCAACCATGACCCGGCAGTGGGTGACCGCCTCCGTGTCATCTTCCTGGAGAACTACCGAGTCTCACTGG
CCGAGAAAGTGATCCCAGCTGCAGACCTCTCTGAGCAGATCTCCACTGCGGGCACTGAAGCCTCAGGCAC
CGGCAACATGAAGTTCATGCTCAACGGGGCTCTGACCATTGGCACCATGGACGGGGCCAATGTGGAGATG
GCAGAAGAGGCGGGAGAGGAAAACTTCTTCATCTTTGGCATGCGGGTGGAGGATGTGGATAAGCTTGACC
AAAGAGGGTACAATGCCCAGGAGTACTACGATCGCATTCCTGAGCTTCGGCAGGTCATTGAGCAGCTGAG
CAGTGGCTTCTTCTCCCCCAAACAGCCCGACCTGTTCAAGGACATTGTCAATATGCTCATGCACCATGAC
CGGTTTAAAGTCTTCGCAGATTATGAAGACTACATTAAATGCCAGGAGAAAGTCAGCGCCTTGTACAAGA
ACCCAAGAGAGTGGACGCGGATGGTGATCCGGAACATAGCCACCTCTGGCAAGTTCTCCAGTGACCGCAC
CATTGCCCAGTATGCCCGGGAGATCTGGGGTGTGGAGCCTTCCCGCCAGCGCCTGCCAGCCCCGGATGAG
GCCATC


ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT
ACAAGGATGACGACGATAAG
GTTTAA
>RC212365 representing NM_005609
Red=Cloning site Green=Tags(s)

MSRPLSDQEKRKQISVRGLAGVENVTELKKNFNRHLHFTLVKDRNVATPRDYYFALAHTVRDHLVGRWIR
TQQHYYEKDPKRIYYLSLEFYMGRTLQNTMVNLALENACDEATYQLGLDMEELEEIEEDAGLGNGGLGRL
AACFLDSMATLGLAAYGYGIRYEFGIFNQKISGGWQMEEADDWLRYGNPWEKARPEFTLPVHFYGHVEHT
SQGAKWVDTQVVLAMPYDTPVPGYRNNVVNTMRLWSAKAPNDFNLKDFNVGGYIQAVLDRNLAENISRVL
YPNDNFFEGKELRLKQEYFVVAATLQDIIRRFKSSKFGCRDPVRTNFDAFPDKVAIQLNDTHPSLAIPEL
MRILVDLERMDWDKAWDVTVRTCAYTNHTVLPEALERWPVHLLETLLPRHLQIIYEINQRFLNRVAAAFP
GDVDRLRRMSLVEEGAVKRINMAHLCIAGSHAVNGVARIHSEILKKTIFKDFYELEPHKFQNKTNGITPR
RWLVLCNPGLAEVIAERIGEDFISDLDQLRKLLSFVDDEAFIRDVAKVKQENKLKFAAYLEREYKVHINP
NSLFDIQVKRIHEYKRQLLNCLHVITLYNRIKREPNKFFVPRTVMIGGKAAPGYHMAKMIIRLVTAIGDV
VNHDPAVGDRLRVIFLENYRVSLAEKVIPAADLSEQISTAGTEASGTGNMKFMLNGALTIGTMDGANVEM
AEEAGEENFFIFGMRVEDVDKLDQRGYNAQEYYDRIPELRQVIEQLSSGFFSPKQPDLFKDIVNMLMHHD
RFKVFADYEDYIKCQEKVSALYKNPREWTRMVIRNIATSGKFSSDRTIAQYAREIWGVEPSRQRLPAPDE
AI

myc-FLAG tag
Chromatograms CHROMATOGRAMS
Sequencher program is needed, download here.
Restriction Sites SgfI-MluI      Cloning Scheme for this gene      Plasmid Map     
Tag Myc-DDK
ACCN NM_005609
ORF Size 2526 bp
OTI Disclaimer The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Product Components The ORF clone is ion-exchange column purified, transfection-ready dried plasmid DNA, and shipped with 2 vector sequencing primers.
Reference Data
RefSeq NM_005609.1, NM_005609.2, NM_005609.3, NP_005600.1
RefSeq Size 3447
RefSeq ORF 2529
Locus ID 5837
Cytogenetics 11q13.1
Domains phosphorylase
Protein Families Druggable Genome
Protein Pathways Insulin signaling pathway, Starch and sucrose metabolism
MW 96.9 kDa
Gene Summary This gene encodes a muscle enzyme involved in glycogenolysis. Highly similar enzymes encoded by different genes are found in liver and brain. Mutations in this gene are associated with McArdle disease (myophosphorylase deficiency), a glycogen storage disease of muscle. Alternative splicing results in multiple transcript variants. [provided by RefSeq, Sep 2009]

Other Versions

Other products for "PYGM"
Frequently bought together (3)
Clone OTI4C5, Anti-DDK (FLAG) monoclonal antibody
    • 100 ul

USD 310.00


pCMV6-Entry, mammalian vector with C-terminal Myc- DDK Tag, 10ug
    • 10 ug

USD 570.00


PYGM mouse monoclonal antibody,clone OTI5D1
    • 100 ul

USD 379.00

Customer Reviews 
Loading...
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.
68 Mouse Clones