Dopamine beta Hydroxylase(DBH) (NM_000787) Human Tagged ORF Clone

CAT#: RC212355

DBH (Myc-DDK-tagged)-Human dopamine beta-hydroxylase (dopamine beta-monooxygenase) (DBH)

Change vector?

USD 783


Availability*
In Stock

Size
    • 10 ug

Product images

Specifications

Product Data
Product Name Dopamine beta Hydroxylase(DBH) (NM_000787) Human Tagged ORF Clone
Symbol DBH
Synonyms DBM
Vector pCMV6-Entry
Sequence Data
ORF Nucleotide Sequence
>RC212355 representing NM_000787
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGCCCGCCCTCAGTCGCTGGGCCAGCCTGCCCGGCCCCAGCATGCGGGAGGCAGCCTTCATGTACAGCA
CAGCAGTGGCCATCTTCCTGGTCATCCTGGTGGCCGCACTGCAGGGCTCGGCTCCCCGTGAGAGCCCCCT
CCCCTATCACATCCCCCTGGACCCGGAGGGGTCCCTGGAGCTCTCATGGAATGTCAGCTACACCCAGGAG
GCCATCCATTTCCAGCTCCTGGTGCGGAGGCTCAAGGCTGGCGTCCTGTTTGGGATGTCCGACCGTGGCG
AGCTTGAGAACGCAGATCTCGTGGTGCTCTGGACCGATGGGGACACTGCCTATTTTGCGGACGCCTGGAG
TGACCAGAAGGGGCAGATCCACCTGGATCCCCAGCAGGACTACCAGCTGCTGCAGGTGCAGAGGACCCCA
GAAGGCCTGACCCTGCTTTTCAAGAGGCCCTTTGGCACCTGCGACCCCAAGGATTACCTCATTGARGACG
GCACTGTCCACTTGGTCTACGGGATCCTGGAGGAGCCGTTCCGGTCACTGGAGGCCATCAACGGCTCGGG
CCTGCAGATGGGGCTGCAGAGGGTGCAGCTCCTGAAGCCCAATATCCCCGAACCGGAGTTGCCCTCAGAC
GCGTGCACCATGGAGGTCCAAGCTCCCAATATCCAGATCCCCAGCCAGGAGACCACGTACTGGTGCTACA
TTAAGGAGCTTCCAAAGGGCTTCTCTCGGCACCACATTATCAAGTACGAGCCCATCGTCACCAAGGGCAA
TGAGGCCCTTGTCCACCACATGGAAGTCTTCCAGTGCGCCCCCGAGATGGACAGCGTCCCCCACTTCAGC
GGGCCCTGCGACTCCAAGATGAAACCCGACCGCCTCAACTACTGCCGCCACGTGCTGGCCGCCTGGGCCC
TGGGTGCCAAGGCATTTTACTACCCAGAGGAAGCCGGCCTTGCCTTCGGGGGTCCAGGGTCCTCCAGATA
TCTCCGCCTGGAAGTTCACTACCACAACCCACTGGTGATAGAAGGACGAAACGACTCCTCAGGCATCCGC
TTGTACTACACAGCCAAGCTGCGGCGCTTCAACGCGGGGATCATGGAGCTGGGACTGGTGTACACGCCAG
TGATGGCCATTCCACCACGGGAGACCGCCTTCATCCTCACTGGCTACTGCACGGACAAGTGCACCCAGCT
GGCACTGCCTCCCTCCGGGATCCACATCTTCGCCTCTCAGCTCCACACACACCTGACTGGGAGAAAGGTG
GTCACAGTGCTGGTCCGGGACGGCCGGGAGTGGGAGATCGTGAACCAGGACAATCACTACAGCCCTCACT
TCCAGGAGATCCGCATGTTGAAGAAGGTCGTGTCGGTCCATCCGGGAGATGTGCTCATCACCTCCTGCAC
GTACAACACGGAAGACCGGGAGCTGGCCACAGTGGGGGGCTTCGGGATCCTGGAGGAGATGTGTGTCAAC
TACGTGCACTACTACCCCCAGACGCAGCTGGAGCTCTGCAAGAGCGCTGTGGACGCCGGCTTCCTGCAGA
AGTACTTCCACCTCATCAACAGGTTCAACAACGAGGATGTCTGCACCTGCCCTCAGGCGTCCGTGTCTCA
GCAGTTCACCTCTGTTCCCTGGAACTCCTTCAACCGCGACGTACTGAAGGCCCTGTACAGCTTCGCGCCC
ATCTCCATGCACTGCAACAAGTCCTCAGCCGTCCGCTTCCAGGGTGAATGGAACCTGCAGCCCCTGCCCA
AGGTCATCTCCACACTGGAAGAGCCCACCCCACAGTGCCCCACCAGCCAGGGCCGAAGCCCTGCTGGCCC
CACCGTTGTCAGCATTGGTGGGGGCAAAGGC


AGCGGACCGACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCC
TGGATTACAAGGATGACGACGATAAG
GTTTAA
Protein Sequence
>RC212355 representing NM_000787
Red=Cloning site Green=Tags(s)

MPALSRWASLPGPSMREAAFMYSTAVAIFLVILVAALQGSAPRESPLPYHIPLDPEGSLELSWNVSYTQE
AIHFQLLVRRLKAGVLFGMSDRGELENADLVVLWTDGDTAYFADAWSDQKGQIHLDPQQDYQLLQVQRTP
EGLTLLFKRPFGTCDPKDYLIXDGTVHLVYGILEEPFRSLEAINGSGLQMGLQRVQLLKPNIPEPELPSD
ACTMEVQAPNIQIPSQETTYWCYIKELPKGFSRHHIIKYEPIVTKGNEALVHHMEVFQCAPEMDSVPHFS
GPCDSKMKPDRLNYCRHVLAAWALGAKAFYYPEEAGLAFGGPGSSRYLRLEVHYHNPLVIEGRNDSSGIR
LYYTAKLRRFNAGIMELGLVYTPVMAIPPRETAFILTGYCTDKCTQLALPPSGIHIFASQLHTHLTGRKV
VTVLVRDGREWEIVNQDNHYSPHFQEIRMLKKVVSVHPGDVLITSCTYNTEDRELATVGGFGILEEMCVN
YVHYYPQTQLELCKSAVDAGFLQKYFHLINRFNNEDVCTCPQASVSQQFTSVPWNSFNRDVLKALYSFAP
ISMHCNKSSAVRFQGEWNLQPLPKVISTLEEPTPQCPTSQGRSPAGPTVVSIGGGKG

SGPTRTRRLEQKLISEEDLAANDILDYKDDDDKV
Chromatograms CHROMATOGRAMS
Sequencher program is needed, download here.
Restriction Sites SgfI-RsrII      Cloning Scheme for this gene      Plasmid Map     
Tag Myc-DDK
ACCN NM_000787
ORF Size 1851 bp
OTI Disclaimer The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Product Components The ORF clone is ion-exchange column purified, transfection-ready dried plasmid DNA, and shipped with 2 vector sequencing primers.
Reference Data
RefSeq NM_000787.3, NP_000778
RefSeq Size 2812
RefSeq ORF 1854
Locus ID 1621
Cytogenetics 9q34.2
Protein Families Secreted Protein, Transmembrane, Druggable Genome
Protein Pathways Tyrosine metabolism, Metabolic pathways
MW 69.06 kDa
Gene Summary The protein encoded by this gene is an oxidoreductase belonging to the copper type II, ascorbate-dependent monooxygenase family. It is present in the synaptic vesicles of postganglionic sympathetic neurons and converts dopamine to norepinephrine. It exists in both soluble and membrane-bound forms, depending on the absence or presence, respectively, of a signal peptide. [provided by RefSeq, Jul 2008]
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Citations