S1P (MBTPS1) (NM_003791) Human Tagged ORF Clone

CAT#: RC212265

Reviews ()
Write a review

MBTPS1 (Myc-DDK-tagged)-Human membrane-bound transcription factor peptidase, site 1 (MBTPS1)



  "NM_003791" in other vectors (6)

Special Offer: 20% off the control vector (empty cloning vector without insert). Use code "Shuttle20".

USD 1,247.00


Availability*
In Stock

Size
    • 10 ug


Product images

Specifications

Product Data
Type Human Tagged ORF Clone
Tag Myc-DDK
Symbol MBTPS1
Synonyms PCSK8; S1P; SEDKF; SKI-1
Vector pCMV6-Entry
E. coli Selection Kanamycin (25 ug/mL)
Mammalian Cell Selection Neomycin
Sequence Data
>RC212265 representing NM_003791
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGAAGCTTGTCAACATCTGGCTGCTTCTGCTCGTGGTTTTGCTCTGTGGGAAGAAACATCTGGGCGACA
GACTGGAAAAGAAATCTTTTGAAAAGGCCCCATGCCCTGGCTGTTCCCACCTGACTTTGAAGGTGGAATT
CTCATCAACAGTTGTGGAATATGAATATATTGTGGCTTTCAATGGATACTTTACAGCCAAAGCTAGAAAT
TCATTTATTTCAAGTGCCCTGAAGAGCAGTGAAGTAGACAATTGGAGAATTATACCTCGAAACAATCCAT
CCAGTGACTACCCTAGTGATTTTGAGGTGATTCAGATAAAAGAAAAACAGAAAGCGGGGCTGCTAACACT
TGAAGATCATCCAAACATCAAACGGGTCACGCCCCAACGAAAAGTCTTTCGTTCCCTCAAGTATGCTGAA
TCTGACCCCACAGTACCCTGCAATGAAACCCGGTGGAGCCAGAAGTGGCAATCATCACGTCCCCTGCGAA
GAGCCAGCCTCTCCCTGGGCTCTGGCTTCTGGCATGCTACGGGAAGGCATTCGAGCAGACGGCTGCTGAG
AGCCATCCCGCGCCAGGTTGCCCAGACACTGCAGGCAGATGTGCTCTGGCAGATGGGATATACAGGTGCT
AATGTAAGAGTTGCTGTTTTTGACACTGGGCTGAGCGAGAAGCATCCCCACTTCAAAAATGTGAAGGAGA
GAACCAACTGGACCAACGAGCGAACGCTGGACGATGGGTTGGGCCATGGCACATTCGTGGCAGGTGTGAT
AGCCAGCATGAGGGAGTGCCAAGGATTTGCTCCAGATGCAGAACTTCACATTTTCAGGGTCTTTACCAAT
AATCAGGTATCTTACACATCTTGGTTTTTGGACGCCTTCAACTATGCCATTTTAAAGAAGATCGACGTGT
TAAACCTCAGCATCGGCGGCCCGGACTTCATGGATCATCCGTTTGTTGACAAGGTGTGGGAATTAACAGC
TAACAATGTAATCATGGTTTCTGCTATTGGCAATGACGGACCTCTTTATGGCACTCTGAATAACCCTGCT
GATCAAATGGATGTGATTGGAGTAGGCGGCATTGACTTTGAAGATAACATCGCCCGCTTTTCTTCAAGGG
GAATGACTACCTGGGAGCTACCAGGAGGCTACGGTCGCATGAAACCTGACATTGTCACCTATGGTGCTGG
CGTGCGGGGTTCTGGCGTGAAAGGGGGGTGCCGGGCCCTCTCAGGGACCAGTGTTGCTTCTCCAGTGGTT
GCAGGTGCTGTCACCTTGTTAGTGAGCACAGTCCAGAAGCGTGAGCTGGTGAATCCCGCCAGTATGAAGC
AGGCCCTGATCGCGTCAGCCCGGAGGCTCCCCGGGGTCAACATGTTTGAGCAAGGCCACGGCAAGCTCGA
TCTGCTCAGAGCCTATCAGATCCTCAACAGCTACAAGCCACAGGCAAGTTTGAGCCCCAGCTACATAGAT
CTGACTGAGTGTCCCTACATGTGGCCCTACTGCTCCCAGCCCATCTACTATGGAGGAATGCCGACAGTTG
TTAATGTCACCATCCTCAACGGCATGGGAGTCACAGGAAGAATTGTAGATAAGCCTGACTGGCAGCCCTA
TTTGCCACAGAACGGAGACAACATTGAAGTTGCCTTCTCCTACTCCTCGGTCTTATGGCCTTGGTCGGGC
TACCTGGCCATCTCCATTTCTGTGACCAAGAAAGCGGCTTCCTGGGAAGGCATTGCTCAGGGCCATGTCA
TGATCACTGTGGCTTCCCCAGCAGAGACAGAGTCAAAAAATGGTGCAGAACAGACTTCAACAGTAAAGCT
CCCCATTAAGGTGAAGATAATTCCTACTCCCCCGCGAAGCAAGAGAGTTCTCTGGGATCAGTACCACAAC
CTCCGCTATCCACCTGGCTATTTCCCCAGGGATAATTTAAGGATGAAGAATGACCCTTTAGACTGGAATG
GTGATCACATCCACACCAATTTCAGGGATATGTACCAGCATCTGAGAAGCATGGGCTACTTTGTAGAGGT
CCTCGGGGCCCCCTTCACGTGTTTTGATGCCAGTCAGTATGGCACTTTGCTGATGGTGGACAGTGAGGAG
GAGTACTTCCCTGAAGAGATCGCCAAGCTCCGGAGGGACGTGGACAACGGCCTCTCGCTCGTCATCTTCA
GTGACTGGTACAACACTTCTGTTATGAGAAAAGTGAAGTTTTATGATGAAAACACAAGGCAGTGGTGGAT
GCCGGATACCGGAGGAGCTAACATCCCAGCTCTGAATGAGCTGCTGTCTGTGTGGAACATGGGGTTCAGC
GATGGCCTGTATGAAGGGGAGTTCACCCTGGCCAACCATGACATGTATTATGCGTCAGGGTGCAGCATCG
CGAAGTTTCCAGAAGATGGCGTCGTGATAACACAGACTTTCAAGGACCAAGGATTGGAGGTTTTAAAGCA
GGAAACAGCAGTTGTTGAAAACGTCCCCATTTTGGGACTTTATCAGATTCCAGCTGAGGGTGGAGGCCGG
ATTGTACTGTATGGGGACTCCAATTGCTTGGATGACAGTCACCGACAGAAGGACTGCTTTTGGCTTCTGG
ATGCCCTCCTCCAGTACACATCGTATGGGGTGACACCGCCTAGCCTCAGTCACTCTGGGAACCGCCAGCG
CCCTCCCAGTGGAGCAGGCTCAGTCACTCCAGAGAGGATGGAAGGAAACCATCTTCATCGGTACTCCAAG
GTTCTGGAGGCCCATTTGGGAGACCCAAAACCTCGGCCTCTACCAGCCTGCCCACGCTTGTCTTGGGCCA
AGCCACAGCCTTTAAACGAGACGGCGCCCAGTAACCTTTGGAAACATCAGAAGCTACTCTCCATTGACCT
GGACAAGGTGGTGTTACCCAACTTTCGATCGAATCGCCCTCAAGTGAGGCCCTTGTCCCCTGGAGAGAGC
GGCGCCTGGGACATTCCTGGAGGGATCATGCCTGGCCGCTACAACCAGGAGGTGGGCCAGACCATTCCTG
TCTTTGCCTTCCTGGGAGCCATGGTGGTCCTGGCCTTCTTTGTGGTACAAATCAACAAGGCCAAGAGCAG
GCCGAAGCGGAGGAAGCCCAGGGTGAAGCGCCCGCAGCTCATGCAGCAGGTTCACCCGCCAAAGACCCCT
TCGGTG


ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT
ACAAGGATGACGACGATAAG
GTTTAA
>RC212265 representing NM_003791
Red=Cloning site Green=Tags(s)

MKLVNIWLLLLVVLLCGKKHLGDRLEKKSFEKAPCPGCSHLTLKVEFSSTVVEYEYIVAFNGYFTAKARN
SFISSALKSSEVDNWRIIPRNNPSSDYPSDFEVIQIKEKQKAGLLTLEDHPNIKRVTPQRKVFRSLKYAE
SDPTVPCNETRWSQKWQSSRPLRRASLSLGSGFWHATGRHSSRRLLRAIPRQVAQTLQADVLWQMGYTGA
NVRVAVFDTGLSEKHPHFKNVKERTNWTNERTLDDGLGHGTFVAGVIASMRECQGFAPDAELHIFRVFTN
NQVSYTSWFLDAFNYAILKKIDVLNLSIGGPDFMDHPFVDKVWELTANNVIMVSAIGNDGPLYGTLNNPA
DQMDVIGVGGIDFEDNIARFSSRGMTTWELPGGYGRMKPDIVTYGAGVRGSGVKGGCRALSGTSVASPVV
AGAVTLLVSTVQKRELVNPASMKQALIASARRLPGVNMFEQGHGKLDLLRAYQILNSYKPQASLSPSYID
LTECPYMWPYCSQPIYYGGMPTVVNVTILNGMGVTGRIVDKPDWQPYLPQNGDNIEVAFSYSSVLWPWSG
YLAISISVTKKAASWEGIAQGHVMITVASPAETESKNGAEQTSTVKLPIKVKIIPTPPRSKRVLWDQYHN
LRYPPGYFPRDNLRMKNDPLDWNGDHIHTNFRDMYQHLRSMGYFVEVLGAPFTCFDASQYGTLLMVDSEE
EYFPEEIAKLRRDVDNGLSLVIFSDWYNTSVMRKVKFYDENTRQWWMPDTGGANIPALNELLSVWNMGFS
DGLYEGEFTLANHDMYYASGCSIAKFPEDGVVITQTFKDQGLEVLKQETAVVENVPILGLYQIPAEGGGR
IVLYGDSNCLDDSHRQKDCFWLLDALLQYTSYGVTPPSLSHSGNRQRPPSGAGSVTPERMEGNHLHRYSK
VLEAHLGDPKPRPLPACPRLSWAKPQPLNETAPSNLWKHQKLLSIDLDKVVLPNFRSNRPQVRPLSPGES
GAWDIPGGIMPGRYNQEVGQTIPVFAFLGAMVVLAFFVVQINKAKSRPKRRKPRVKRPQLMQQVHPPKTP
SV

myc-FLAG tag
Chromatograms CHROMATOGRAMS
Sequencher program is needed, download here.
Restriction Sites SgfI-MluI      Cloning Scheme for this gene      Plasmid Map     
ACCN NM_003791
ORF Size 3156 bp
OTI Disclaimer The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Product Components The ORF clone is ion-exchange column purified and shipped in a 2D barcoded Matrix tube containing 10ug of transfection-ready, dried plasmid DNA (reconstitute with 100 ul of water).
Reconstitution 1. Centrifuge at 5,000xg for 5min.
2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA.
3. Close the tube and incubate for 10 minutes at room temperature.
4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom.
5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C.
Reference Data
RefSeq NM_003791.4
RefSeq Size 4354 bp
RefSeq ORF 3159 bp
Locus ID 8720
UniProt ID Q14703
Cytogenetics 16q23.3-q24.1
Domains Peptidase_S8
Protein Families Druggable Genome, Protease, Transcription Factors, Transmembrane
MW 117.75 kDa
Gene Summary This gene encodes a member of the subtilisin-like proprotein convertase family, which includes proteases that process protein and peptide precursors trafficking through regulated or constitutive branches of the secretory pathway. The encoded protein undergoes an initial autocatalytic processing event in the ER to generate a heterodimer which exits the ER and sorts to the cis/medial-Golgi where a second autocatalytic event takes place and the catalytic activity is acquired. It encodes a type 1 membrane bound protease which is ubiquitously expressed and regulates cholesterol or lipid homeostasis via cleavage of substrates at non-basic residues. Mutations in this gene may be associated with lysosomal dysfunction. [provided by RefSeq, Feb 2014]

Other Versions

Other products for "MBTPS1"
Frequently bought together (5)
Clone OTI4C5, Anti-DDK (FLAG) monoclonal antibody
    • 30 ul

USD 165.00


pCMV6-Entry, mammalian vector with C-terminal Myc- DDK Tag, 10ug
    • 10 ug

USD 627.00


Rabbit polyclonal anti-MBTPS1 antibody
    • 100 ul

USD 380.00


DH5α Chemically Competent Cells (≥10^8 cfu/μg of pUC19 DNA)
    • 5 x 200 ul

USD 149.00


Forward sequencing primer VP1.5, Reverse sequencing primer XL39, 100pmoles each
    • 100 pmol

USD 55.00

Customer Reviews 
Loading...
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.