Annexin A11 (ANXA11) (NM_001157) Human Tagged ORF Clone

CAT#: RC212191

Reviews ()
Write a review

ANXA11 (Myc-DDK-tagged)-Human annexin A11 (ANXA11), transcript variant a



Reconstitution Protocol

USD 470.00

In Stock*

Size
    • 10 ug

Other products for "ANXA11"

Specifications

Product Data
Type Human Tagged ORF Clone
Tag Myc-DDK
Symbol ANXA11
Synonyms ALS23; ANX11; CAP-50; CAP50
Vector pCMV6-Entry
E. coli Selection Kanamycin (25 ug/mL)
Mammalian Cell Selection Neomycin
Sequence Data
>RC212191 ORF sequence
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGAGCTACCCTGGCTATCCCCCGCCCCCAGGTGGCTACCCACCAGCTGCACCAGGTGGTGGTCCCTGGG
GAGGTGCTGCCTACCCTCCTCCGCCCAGCATGCCCCCCATCGGGCTGGATAACGTGGCCACCTATGCGGG
GCAGTTCAACCAGGACTATCTCTCGGGAATGGCGGCCAACATGTCTGGGACATTTGGAGGAGCCAACATG
CCCAACCTGTACCCTGGGGCCCCTGGGGCTGGCTACCCACCAGTGCCCCCTGGCGGCTTTGGGCAGCCCC
CCTCTGCCCAGCAGCCTGTTCCTCCCTATGGGATGTATCCACCCCCAGGAGGAAACCCACCCTCCAGGAT
GCCCTCATATCCGCCATACCCAGGGGCCCCTGTGCCGGGCCAGCCCATGCCACCCCCCGGACAGCAGCCC
CCAGGGGCCTACCCTGGGCAGCCACCAGTGACCTACCCTGGTCAGCCTCCAGTGCCACTCCCTGGGCAGC
AGCAGCCAGTGCCGAGCTACCCAGGATACCCGGGGTCTGGGACTGTCACCCCCGCTGTGCCCCCAACCCA
GTTTGGAAGCCGAGGCACCATCACTGATGCTCCCGGCTTTGACCCCCTGCGAGATGCCGAGGTCCTGCGG
AAGGCCATGAAAGGCTTCGGGACGGATGAGCAGGCCATCATTGACTGCCTGGGGAGTCGCTCCAACAAGC
AGCGGCAGCAGATCCTACTTTCCTTCAAGACGGCTTACGGCAAGGATTTGATCAAAGATCTGAAATCTGA
ACTGTCAGGAAACTTTGAGAAGACAATCTTGGCTCTGATGAAGACCCCAGTCCTCTTTGACATTTATGAG
ATAAAGGAAGCCATCAAGGGGGTTGGCACTGATGAAGCCTGCCTGATTGAGATCCTCGCTTCCCGCAGCA
ATGAGCACATCCGAGAATTAAACAGAGCCTACAAAGCAGAATTCAAAAAGACCCTGGAAGAGGCCATTCG
AAGCGACACATCAGGGCACTTCCAGCGGCTCCTCATCTCTCTCTCTCAGGGAAACCGTGATGAAAGCACA
AACGTGGACATGTCACTCGCCCAGAGAGATGCCCAGGAGCTGTATGCGGCCGGGGAGAACCGCCTGGGAA
CAGACGAGTCCAAGTTCAATGCGGTTCTGTGCTCCCGGAGCCGGGCCCACCTGGTAGCAGTTTTCAATGA
GTACCAGAGAATGACAGGCCGGGACATTGAGAAGAGCATCTGCCGGGAGATGTCCGGGGACCTGGAGGAG
GGCATGCTGGCCGTGGTGAAATGTCTCAAGAATACCCCAGCCTTCTTTGCGGAGAGGCTCAACAAGGCCA
TGAGGGGGGCAGGAACAAAGGACCGGACCCTGATTCGCATCATGGTGTCTCGCAGCGAGACCGACCTCCT
GGACATCAGATCAGAGTATAAGCGGATGTACGGCAAGTCGCTGTACCACGACATCTCGGGAGATACTTCA
GGGGATTACCGGAAGATTCTGCTGAAGATCTGTGGTGGCAATGAC


ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT
ACAAGGATGACGACGATAAG
GTTTAA
>RC212191 protein sequence
Red=Cloning site Green=Tags(s)

MSYPGYPPPPGGYPPAAPGGGPWGGAAYPPPPSMPPIGLDNVATYAGQFNQDYLSGMAANMSGTFGGANM
PNLYPGAPGAGYPPVPPGGFGQPPSAQQPVPPYGMYPPPGGNPPSRMPSYPPYPGAPVPGQPMPPPGQQP
PGAYPGQPPVTYPGQPPVPLPGQQQPVPSYPGYPGSGTVTPAVPPTQFGSRGTITDAPGFDPLRDAEVLR
KAMKGFGTDEQAIIDCLGSRSNKQRQQILLSFKTAYGKDLIKDLKSELSGNFEKTILALMKTPVLFDIYE
IKEAIKGVGTDEACLIEILASRSNEHIRELNRAYKAEFKKTLEEAIRSDTSGHFQRLLISLSQGNRDEST
NVDMSLAQRDAQELYAAGENRLGTDESKFNAVLCSRSRAHLVAVFNEYQRMTGRDIEKSICREMSGDLEE
GMLAVVKCLKNTPAFFAERLNKAMRGAGTKDRTLIRIMVSRSETDLLDIRSEYKRMYGKSLYHDISGDTS
GDYRKILLKICGGND

myc-FLAG tag
Chromatograms CHROMATOGRAMS
Sequencher program is needed, download here.
Restriction Sites SgfI-MluI      Cloning Scheme for this gene      Plasmid Map     
ACCN NM_001157
ORF Size 1515 bp
OTI Disclaimer The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Product Components The ORF clone is ion-exchange column purified and shipped in a 2D barcoded Matrix tube containing 10ug of transfection-ready, dried plasmid DNA (reconstitute with 100 ul of water).
Reconstitution 1. Centrifuge at 5,000xg for 5min.
2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA.
3. Close the tube and incubate for 10 minutes at room temperature.
4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom.
5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C.
Reference Data
RefSeq NM_001157.3
RefSeq Size 2486 bp
RefSeq ORF 1518 bp
Locus ID 311
UniProt ID P50995
Cytogenetics 10q22.3
Domains annexin
MW 54.4 kDa
Gene Summary This gene encodes a member of the annexin family, a group of calcium-dependent phospholipid-binding proteins. Annexins have unique N-terminal domains and conserved C-terminal domains, which contain calcium-dependent phospholipid-binding sites. The encoded protein is a 56-kD antigen recognized by sera from patients with various autoimmune diseases. Several transcript variants encoding two different isoforms have been identified. [provided by RefSeq, Dec 2015]
Customer Reviews 
Loading...
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.