TBC1D4 (NM_014832) Human Tagged ORF Clone

CAT#: RC212105

Reviews ()
Write a review

TBC1D4 (Myc-DDK-tagged)-Human TBC1 domain family, member 4 (TBC1D4)



Reconstitution Protocol

USD 1,696.00

In Stock*

Size
    • 10 ug

Product images

Other products for "TBC1D4"

Specifications

Product Data
Type Human Tagged ORF Clone
Tag Myc-DDK
Symbol TBC1D4
Synonyms AS160; NIDDM5
Vector pCMV6-Entry
E. coli Selection Kanamycin (25 ug/mL)
Mammalian Cell Selection Neomycin
Sequence Data
>RC212105 representing NM_014832
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGGAGCCGCCCAGCTGCATTCAGGATGAGCCGTTCCCGCACCCCCTGGAGCCCGAGCCGGGCGTCTCAG
CTCAGCCCGGCCCCGGGAAGCCAAGCGATAAGCGGTTCCGGCTGTGGTACGTTGGGGGGTCGTGCCTGGA
CCACAGGACCACGCTGCCTATGCTGCCCTGGCTCATGGCCGAGATCCGCAGGCGCAGCCAGAAGCCCGAG
GCGGGCGGCTGCGGGGCGCCGGCGGCCCGAGAGGTGATCCTGGTGCTCAGCGCGCCCTTCCTGCGTTGCG
TCCCCGCGCCGGGCGCTGGGGCCTCGGGGGGCACTAGTCCGTCGGCCACGCAGCCCAACCCGGCGGTATT
CATCTTCGAGCACAAGGCGCAGCATATCTCGCGCTTCATCCACAACAGCCACGACCTCACCTACTTTGCC
TACCTGATCAAGGCGCAGCCCGACGACCCCGAGTCGCAGATGGCCTGCCACGTTTTCCGCGCCACAGACC
CCAGCCAGGTTCCTGATGTTATTAGCAGCATAAGGCAATTATCTAAAGCGGCCATGAAAGAGGATGCCAA
ACCCAGCAAAGATAATGAGGACGCCTTTTACAACTCTCAGAAGTTCGAAGTCCTGTACTGTGGAAAGGTG
ACCGTGACCCACAAGAAGGCCCCCTCAAGCCTCATCGATGACTGCATGGAGAAGTTCAGCCTGCACGAAC
AGCAGCGCCTGAAGATCCAAGGGGAGCAGCGCGGTCCGGACCCAGGAGAGGACCTGGCTGACTTGGAGGT
GGTGGTGCCCGGGTCCCCCGGAGACTGCCTGCCGGAGGAGGCTGACGGCACCGACACCCACCTTGGCTTA
CCTGCCGGGGCCAGCCAGCCTGCCCTGACCAGCTCTCGGGTCTGCTTCCCTGAGCGGATTTTGGAAGATT
CTGGCTTTGATGAGCAGCAGGAGTTTCGGTCTCGGTGCAGCAGTGTCACCGGCGTGCAACGGAGAGTTCA
CGAGGGCAGCCAGAAATCCCAGCCGCGACGGAGACACGCGAGCGCACCCAGTCACGTCCAGCCCTCGGAC
TCGGAGAAGAACAGGACCATGCTCTTCCAGGTTGGGCGATTTGAGATTAACCTTATCAGTCCAGACACTA
AATCAGTTGTGCTAGAAAAGAATTTTAAAGATATCTCCTCTTGTTCTCAGGGTATAAAGCATGTGGATCA
CTTTGGCTTTATCTGCCGGGAGTCTCCAGAGCCTGGACTTAGCCAGTATATTTGTTATGTATTCCAGTGT
GCCAGCGAATCTCTGGTTGATGAGGTAATGCTGACTCTGAAACAGGCCTTCAGTACGGCGGCTGCCCTGC
AGAGTGCCAAGACGCAGATTAAACTGTGTGAGGCCTGCCCGATGCACTCTTTGCATAAGCTCTGTGAAAG
GATTGAAGGTCTCTACCCACCAAGAGCCAAGCTGGTGATACAGAGGCATCTCTCATCACTGACAGATAAT
GAGCAAGCTGACATCTTTGAAAGAGTTCAGAAAATGAAGCCAGTCAGTGACCAGGAAGAAAATGAACTTG
TGATTTTACACCTGAGGCAGCTGTGTGAAGCCAAGCAGAAGACACACGTGCACATCGGGGAAGGCCCTTC
TACTATTTCAAATAGTACAATCCCAGAAAATGCAACAAGCAGTGGAAGGTTCAAACTTGACATTCTGAAA
AATAAAGCTAAGAGATCCTTAACTAGCTCCCTGGAAAATATCTTCTCAAGGGGAGCTAACAGAATGAGAG
GTCGGCTTGGAAGTGTGGACAGTTTTGAACGGTCCAACAGTCTTGCTTCAGAGAAGGACTACTCACCAGG
GGATTCTCCACCAGGGACACCGCCAGCGTCCCCACCGTCCTCAGCTTGGCAAACGTTTCCCGAAGAGGAT
TCCGACTCCCCGCAGTTTCGAAGACGGGCACACACGTTCAGCCACCCACCTTCAAGCACAAAGAGAAAGC
TGAATTTGCAGGATGGGAGGGCTCAGGGTGTGCGTTCCCCTCTGCTGAGGCAGAGCTCCAGTGAACAGTG
CAGCAATCTTTCGTCAGTTCGACGCATGTACAAGGAGAGTAATTCTTCCTCCAGTCTTCCAAGTCTTCAC
ACTTCCTTCTCTGCCCCTTCCTTCACTGCCCCCTCTTTCCTGAAAAGCTTTTACCAGAATTCAGGTAGAC
TGTCCCCACAGTATGAAAATGAAATCAGACAAGACACTGCTTCAGAATCAAGTGATGGAGAAGGGAGAAA
AAGGACCTCATCTACCTGCAGCAATGAGTCCCTAAGTGTGGGAGGAACCTCTGTCACTCCTCGCCGGATC
TCCTGGCGGCAGCGCATTTTCCTCAGGGTTGCTTCTCCCATGAACAAATCTCCCTCAGCAATGCAACAGC
AAGATGGATTGGACAGGAACGAGCTGCTGTCACTGTCCCCCCTCTCTCCAACCATGGAGGAGGAACCGCT
GGTTGTATTCCTGTCTGGGGAGGATGACCCAGAAAAGATTGAAGAAAGAAAGAAATCAAAAGAACTGAGG
AGCTTGTGGAGAAAAGCTATACACCAACAAATCTTGTTACTTCGAATGGAAAAAGAAAACCAGAAACTTG
AAGGAGCAAGCAGAGATGAACTCCAGTCCAGAAAAGTTAAATTAGACTATGAAGAAGTTGGTGCATGTCA
GAAAGAGGTCTTAATAACTTGGGATAAGAAGTTGTTAAACTGCAGAGCTAAAATCAGATGTGATATGGAA
GATATTCATACTCTTCTTAAAGAAGGAGTTCCCAAAAGTCGACGAGGAGAAATTTGGCAGTTTCTGGCTT
TACAGTACCGACTCAGACACAGATTGCCTAATAAACAACAGCCTCCTGACATATCCTATAAGGAACTTTT
GAAGCAGCTCACTGCTCAGCAGCATGCGATTCTCGTGGATTTAGGAAGGACGTTTCCTACTCACCCTTAC
TTTTCAGTACAGCTTGGGCCAGGACAGCTGTCACTGTTTAACCTCCTGAAAGCCTATTCTTTGCTGGACA
AAGAAGTGGGATACTGTCAGGGGATCAGCTTTGTGGCTGGAGTCCTGCTTCTGCACATGAGTGAAGAGCA
AGCCTTTGAAATGCTGAAATTCCTCATGTATGACCTCGGCTTCCGCAAGCAGTACAGACCTGACATGATG
TCGCTGCAGATTCAAATGTACCAGCTGTCCAGGCTCCTTCATGACTATCACAGAGATCTCTACAATCACC
TTGAAGAAAATGAAATCAGCCCCAGTCTTTATGCTGCCCCCTGGTTCCTCACATTGTTTGCCTCTCAGTT
TTCATTAGGATTTGTAGCCAGAGTTTTTGATATTATTTTTCTTCAGGGAACTGAAGTTATATTCAAGGTT
GCACTCAGCCTACTGAGCAGCCAAGAGACACTTATAATGGAATGTGAGAGCTTTGAAAATATTGTTGAGT
TTCTTAAAAACACGCTACCTGATATGAATACCTCTGAAATGGAAAAAATTATTACCCAGGTTTTTGAGAT
GGATATTTCTAAGCAGTTGCATGCCTATGAGGTGGAATATCATGTGCTACAGGATGAGCTTCAGGAATCT
TCATATTCCTGTGAGGATAGTGAAACTTTGGAGAAGCTGGAGAGGGCCAATAGCCAACTGAAAAGACAAA
ACATGGACCTCCTAGAAAAATTACAGGTAGCTCATACTAAAATCCAGGCCTTGGAATCAAACCTGGAAAA
TCTTTTGACGAGAGAGACCAAAATGAAGTCTTTAATCCGGACCCTGGAACAAGAAAAAATGGCTTATCAA
AAGACAGTGGAGCAACTCCGGAAGCTGCTGCCCGCGGATGCTCTAGTCAATTGTGACCTGTTGCTGAGAG
ACCTAAACTGCAACCCTAACAACAAAGCCAAGATAGGAAATAAGCCA


ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT
ACAAGGATGACGACGATAAG
GTTTAA
>RC212105 representing NM_014832
Red=Cloning site Green=Tags(s)

MEPPSCIQDEPFPHPLEPEPGVSAQPGPGKPSDKRFRLWYVGGSCLDHRTTLPMLPWLMAEIRRRSQKPE
AGGCGAPAAREVILVLSAPFLRCVPAPGAGASGGTSPSATQPNPAVFIFEHKAQHISRFIHNSHDLTYFA
YLIKAQPDDPESQMACHVFRATDPSQVPDVISSIRQLSKAAMKEDAKPSKDNEDAFYNSQKFEVLYCGKV
TVTHKKAPSSLIDDCMEKFSLHEQQRLKIQGEQRGPDPGEDLADLEVVVPGSPGDCLPEEADGTDTHLGL
PAGASQPALTSSRVCFPERILEDSGFDEQQEFRSRCSSVTGVQRRVHEGSQKSQPRRRHASAPSHVQPSD
SEKNRTMLFQVGRFEINLISPDTKSVVLEKNFKDISSCSQGIKHVDHFGFICRESPEPGLSQYICYVFQC
ASESLVDEVMLTLKQAFSTAAALQSAKTQIKLCEACPMHSLHKLCERIEGLYPPRAKLVIQRHLSSLTDN
EQADIFERVQKMKPVSDQEENELVILHLRQLCEAKQKTHVHIGEGPSTISNSTIPENATSSGRFKLDILK
NKAKRSLTSSLENIFSRGANRMRGRLGSVDSFERSNSLASEKDYSPGDSPPGTPPASPPSSAWQTFPEED
SDSPQFRRRAHTFSHPPSSTKRKLNLQDGRAQGVRSPLLRQSSSEQCSNLSSVRRMYKESNSSSSLPSLH
TSFSAPSFTAPSFLKSFYQNSGRLSPQYENEIRQDTASESSDGEGRKRTSSTCSNESLSVGGTSVTPRRI
SWRQRIFLRVASPMNKSPSAMQQQDGLDRNELLSLSPLSPTMEEEPLVVFLSGEDDPEKIEERKKSKELR
SLWRKAIHQQILLLRMEKENQKLEGASRDELQSRKVKLDYEEVGACQKEVLITWDKKLLNCRAKIRCDME
DIHTLLKEGVPKSRRGEIWQFLALQYRLRHRLPNKQQPPDISYKELLKQLTAQQHAILVDLGRTFPTHPY
FSVQLGPGQLSLFNLLKAYSLLDKEVGYCQGISFVAGVLLLHMSEEQAFEMLKFLMYDLGFRKQYRPDMM
SLQIQMYQLSRLLHDYHRDLYNHLEENEISPSLYAAPWFLTLFASQFSLGFVARVFDIIFLQGTEVIFKV
ALSLLSSQETLIMECESFENIVEFLKNTLPDMNTSEMEKIITQVFEMDISKQLHAYEVEYHVLQDELQES
SYSCEDSETLEKLERANSQLKRQNMDLLEKLQVAHTKIQALESNLENLLTRETKMKSLIRTLEQEKMAYQ
KTVEQLRKLLPADALVNCDLLLRDLNCNPNNKAKIGNKP

myc-FLAG tag
Chromatograms CHROMATOGRAMS
Sequencher program is needed, download here.
Restriction Sites SgfI-MluI      Cloning Scheme for this gene      Plasmid Map     
ACCN NM_014832
ORF Size 3897 bp
OTI Disclaimer Due to the inherent nature of this plasmid, standard methods to replicate additional amounts of DNA in E. coli are highly likely to result in mutations and/or rearrangements. Therefore, OriGene does not guarantee the capability to replicate this plasmid DNA. Additional amounts of DNA can be purchased from OriGene with batch-specific, full-sequence verification at a reduced cost. Please contact our customer care team at custsupport@origene.com or by calling 301.340.3188 option 3 for pricing and delivery.

The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Product Components The ORF clone is ion-exchange column purified and shipped in a 2D barcoded Matrix tube containing 10ug of transfection-ready, dried plasmid DNA (reconstitute with 100 ul of water).
Reconstitution 1. Centrifuge at 5,000xg for 5min.
2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA.
3. Close the tube and incubate for 10 minutes at room temperature.
4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom.
5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C.
Reference Data
RefSeq NM_014832.5
RefSeq Size 5922 bp
RefSeq ORF 3897 bp
Locus ID 9882
UniProt ID O60343
Cytogenetics 13q22.2
Domains TBC, PID
MW 146.4 kDa
Gene Summary This gene is a member of the Tre-2/BUB2/CDC16 domain family. The protein encoded by this gene is a Rab-GTPase-activating protein, and contains two phopshotyrosine-binding domains (PTB1 and PTB2), a calmodulin-binding domain (CBD), a Rab-GTPase domain, and multiple AKT phosphomotifs. This protein is thought to play an important role in glucose homeostasis by regulating the insulin-dependent trafficking of the glucose transporter 4 (GLUT4), important for removing glucose from the bloodstream into skeletal muscle and fat tissues. Reduced expression of this gene results in an increase in GLUT4 levels at the plasma membrane, suggesting that this protein is important in intracellular retention of GLUT4 under basal conditions. When exposed to insulin, this protein is phosphorylated, dissociates from GLUT4 vesicles, resulting in increased GLUT4 at the cell surface, and enhanced glucose transport. Phosphorylation of this protein by AKT is required for proper translocation of GLUT4 to the cell surface. Individuals homozygous for a mutation in this gene are at higher risk for type 2 diabetes and have higher levels of circulating glucose and insulin levels after glucose ingestion. Alternative splicing results in multiple transcript variants encoding different isoforms. [provided by RefSeq, Aug 2015]
Customer Reviews 
Loading...
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.