HRK (NM_003806) Human Tagged ORF Clone

CAT#: RC212069

HRK (Myc-DDK-tagged)-Human harakiri, BCL2 interacting protein (contains only BH3 domain) (HRK)

Product Images

Circular map for RC212069

• 

  Western blot validation of overexpression lysate (Cat# LY401253) using anti-DDK antibody (Cat# TA50011-100). Left: Cell lysates from un-transfected HEK293T cells; Right: Cell lysates from HEK293T cells transfected with RC212069 using transfection reagent MegaTran 2.0 (Cat# TT210002).

Specifications

Product Data

• Type: Human Tagged ORF Clone
• Tag: Myc-DDK
• Symbol: HRK
• Synonyms: DP5; HARAKIRI
• Vector: pCMV6-Entry
• E. coli Selection: Kanamycin (25 ug/mL)
• Mammalian Cell Selection: Neomycin
• Sequence Data:
  ORF Nucleotide Sequence

  >RC212069 representing NM_003806
  Red=Cloning site Blue=ORF Green=Tags(s)
  
  TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
  GCCGCGATCGCC
  
  ATGTGCCCGTGCCCCCTGCACCGCGGCCGCGGCCCCCCGGCCGTGTGCGCCTGCAGCGCGGGTCGCCTGG
  GGCTGCGCTCGTCCGCCGCGCAGCTCACCGCCGCCCGGCTCAAGGCGCTAGGCGACGAGCTGCACCAGCG
  CACCATGTGGCGGCGCCGCGCGCGGAGCCGGAGGGCGCCGGCGCCCGGCGCGCTCCCCACCTACTGGCCT
  TGGCTGTGCGCGGCCGCGCAGGTGGCGGCGCTGGCGGCCTGGCTGCTCGGCAGGCGGAACTTG
  
  ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT
  ACAAGGATGACGACGATAAGGTTTAA
  Protein Sequence

  >RC212069 representing NM_003806
  Red=Cloning site Green=Tags(s)
  
  MCPCPLHRGRGPPAVCACSAGRLGLRSSAAQLTAARLKALGDELHQRTMWRRRARSRRAPAPGALPTYWP
  WLCAAAQVAALAAWLLGRRNL
  
  myc-FLAG tag
• Restriction Sites: SgfI-MluI Cloning Scheme for this gene Plasmid Map
• ACCN: NM_003806
• ORF Size: 273 bp
• OTI Disclaimer: The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
• OTI Annotation: This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
• Product Components: The ORF clone is ion-exchange column purified and shipped in a 2D barcoded Matrix tube containing 10ug of transfection-ready, dried plasmid DNA (reconstitute with 100 ul of water).
• Reconstitution: 1. Centrifuge at 5,000xg for 5min.
  2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA.
  3. Close the tube and incubate for 10 minutes at room temperature.
  4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom.
  5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C.

Reference Data

• RefSeq: NM_003806.4
• RefSeq Size: 716 bp
• RefSeq ORF: 276 bp
• Locus ID: 8739
• UniProt ID: O00198
• Cytogenetics: 12q24.22
• Protein Families: Druggable Genome, Transmembrane
• MW: 9.7 kDa
• Gene Summary: This gene encodes a member of the BCL-2 protein family. Members of this family are involved in activating or inhibiting apoptosis. The encoded protein localizes to intracellular membranes. This protein promotes apoptosis by interacting with the apoptotic inhibitors BCL-2 and BCL-X(L) via its BH3 domain. Alternate splicing results in multiple transcript variants. [provided by RefSeq, Oct 2012]