HRK (NM_003806) Human Tagged ORF Clone
CAT#: RC212069
HRK (Myc-DDK-tagged)-Human harakiri, BCL2 interacting protein (contains only BH3 domain) (HRK)
ORF Plasmid: tGFP
Lentiviral Particles: DDK DDK w/ Puro mGFP mGFP w/ Puro
AAV Particle: DDK
"NM_003806" in other vectors (6)
USD 198.00
Specifications
Product Data | |
Type | Human Tagged ORF Clone |
Tag | Myc-DDK |
Symbol | HRK |
Synonyms | DP5; HARAKIRI |
Vector | pCMV6-Entry |
E. coli Selection | Kanamycin (25 ug/mL) |
Mammalian Cell Selection | Neomycin |
Sequence Data |
>RC212069 representing NM_003806
Red=Cloning site Blue=ORF Green=Tags(s) TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC GCCGCGATCGCC ATGTGCCCGTGCCCCCTGCACCGCGGCCGCGGCCCCCCGGCCGTGTGCGCCTGCAGCGCGGGTCGCCTGG GGCTGCGCTCGTCCGCCGCGCAGCTCACCGCCGCCCGGCTCAAGGCGCTAGGCGACGAGCTGCACCAGCG CACCATGTGGCGGCGCCGCGCGCGGAGCCGGAGGGCGCCGGCGCCCGGCGCGCTCCCCACCTACTGGCCT TGGCTGTGCGCGGCCGCGCAGGTGGCGGCGCTGGCGGCCTGGCTGCTCGGCAGGCGGAACTTG ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT ACAAGGATGACGACGATAAGGTTTAA >RC212069 representing NM_003806
Red=Cloning site Green=Tags(s) MCPCPLHRGRGPPAVCACSAGRLGLRSSAAQLTAARLKALGDELHQRTMWRRRARSRRAPAPGALPTYWP WLCAAAQVAALAAWLLGRRNL myc-FLAG tag |
Chromatograms |
CHROMATOGRAMS
Sequencher program is needed, download here. |
Restriction Sites | SgfI-MluI Cloning Scheme for this gene Plasmid Map |
ACCN | NM_003806 |
ORF Size | 273 bp |
OTI Disclaimer | The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info |
OTI Annotation | This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene. |
Product Components | The ORF clone is ion-exchange column purified and shipped in a 2D barcoded Matrix tube containing 10ug of transfection-ready, dried plasmid DNA (reconstitute with 100 ul of water). |
Reconstitution | 1. Centrifuge at 5,000xg for 5min. 2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA. 3. Close the tube and incubate for 10 minutes at room temperature. 4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom. 5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C. |
Reference Data | |
RefSeq | NM_003806.4 |
RefSeq Size | 716 bp |
RefSeq ORF | 276 bp |
Locus ID | 8739 |
UniProt ID | O00198 |
Cytogenetics | 12q24.22 |
Protein Families | Druggable Genome, Transmembrane |
MW | 9.7 kDa |
Gene Summary | This gene encodes a member of the BCL-2 protein family. Members of this family are involved in activating or inhibiting apoptosis. The encoded protein localizes to intracellular membranes. This protein promotes apoptosis by interacting with the apoptotic inhibitors BCL-2 and BCL-X(L) via its BH3 domain. Alternate splicing results in multiple transcript variants. [provided by RefSeq, Oct 2012] |
Documents
Product Manuals |
FAQs |
SDS |
Resources
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
RC212069L1 | Lenti ORF clone of Human harakiri, BCL2 interacting protein (contains only BH3 domain) (HRK), Myc-DDK-tagged |
USD 450.00 |
|
RC212069L2 | Lenti ORF clone of Human harakiri, BCL2 interacting protein (contains only BH3 domain) (HRK), mGFP tagged |
USD 450.00 |
|
RC212069L3 | Lenti ORF clone of Human harakiri, BCL2 interacting protein (contains only BH3 domain) (HRK), Myc-DDK-tagged |
USD 450.00 |
|
RC212069L4 | Lenti ORF clone of Human harakiri, BCL2 interacting protein (contains only BH3 domain) (HRK), mGFP tagged |
USD 450.00 |
|
RG212069 | HRK (tGFP-tagged) - Human harakiri, BCL2 interacting protein (contains only BH3 domain) (HRK) |
USD 350.00 |
|
SC303381 | HRK (untagged)-Human harakiri, BCL2 interacting protein (contains only BH3 domain) (HRK) |
USD 150.00 |
{0} Product Review(s)
Be the first one to submit a review