PIGR (NM_002644) Human Tagged ORF Clone

CAT#: RC212006

Reviews ()
Write a review

PIGR (Myc-DDK-tagged)-Human polymeric immunoglobulin receptor (PIGR)



Reconstitution Protocol

USD 700.00

In Stock*

Size
    • 10 ug

Product images

Other products for "PIGR"

Specifications

Product Data
Type Human Tagged ORF Clone
Tag Myc-DDK
Symbol PIGR
Vector pCMV6-Entry
E. coli Selection Kanamycin (25 ug/mL)
Mammalian Cell Selection Neomycin
Sequence Data
>RC212006 representing NM_002644
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGCTGCTCTTCGTGCTCACCTGCCTGCTGGCGGTCTTCCCAGCCATCTCCACGAAGAGTCCCATATTTG
GTCCCGAGGAGGTGAATAGTGTGGAAGGTAACTCAGTGTCCATCACGTGCTACTACCCACCCACCTCTGT
CAACCGGCACACCCGGAAGTACTGGTGCCGGCAGGGAGCTAGAGGTGGCTGCATAACCCTCATCTCCTCG
GAGGGCTACGTCTCCAGCAAATATGCAGGCAGGGCTAACCTCACCAACTTCCCGGAGAACGGCACATTTG
TGGTGAACATTGCCCAGCTGAGCCAGGATGACTCCGGGCGCTACAAGTGTGGCCTGGGCATCAATAGCCG
AGGCCTGTCCTTTGATGTCAGCCTGGAGGTCAGCCAGGGTCCTGGGCTCCTAAATGACACTAAAGTCTAC
ACAGTGGACCTGGGCAGAACGGTGACCATCAACTGCCCTTTCAAGACTGAGAATGCTCAAAAGAGGAAGT
CCTTGTACAAGCAGATAGGCCTGTACCCTGTGCTGGTCATCGACTCCAGTGGTTATGTAAATCCCAACTA
TACAGGAAGAATACGCCTTGATATTCAGGGTACTGGCCAGTTACTGTTCAGCGTTGTCATCAACCAACTC
AGGCTCAGCGATGCTGGGCAGTATCTCTGCCAGGCTGGGGATGATTCCAATAGTAATAAGAAGAATGCTG
ACCTCCAAGTGCTAAAGCCCGAGCCCGAGCTGGTTTATGAAGACCTGAGGGGCTCAGTGACCTTCCACTG
TGCCCTGGGCCCTGAGGTGGCAAACGTGGCCAAATTTCTGTGCCGACAGAGCAGTGGGGAAAACTGTGAC
GTGGTCGTCAACACCCTGGGGAAGAGGGCCCCAGCCTTTGAGGGCAGGATCCTGCTCAACCCCCAGGACA
AGGATGGCTCATTCAGTGTGGTGATCACAGGCCTGAGGAAGGAGGATGCAGGGCGCTACCTGTGTGGAGC
CCATTCGGATGGTCAGCTGCAGGAAGGCTCGCCTATCCAGGCCTGGCAACTCTTCGTCAATGAGGAGTCC
ACGATTCCCCGCAGCCCCACTGTGGTGAAGGGGGTGGCAGGAGGCTCTGTGGCCGTGCTCTGCCCCTACA
ACCGTAAGGAAAGCAAAAGCATCAAGTACTGGTGTCTCTGGGAAGGGGCCCAGAATGGCCGCTGCCCCCT
GCTGGTGGACAGCGAGGGGTGGGTTAAGGCCCAGTACGAGGGCCGCCTCTCCCTGCTGGAGGAGCCAGGC
AACGGCACCTTCACTGTCATCCTCAACCAGCTCACCAGCCGGGACGCCGGCTTCTACTGGTGTCTGACCA
ACGGCGATACTCTCTGGAGGACCACCGTGGAGATCAAGATTATCGAAGGAGAACCAAACCTCAAGGTACC
AGGGAATGTCACGGCTGTGCTGGGAGAGACTCTCAAGGTCCCCTGTCACTTTCCATGCAAATTCTCCTCG
TACGAGAAATACTGGTGCAAGTGGAATAACACGGGCTGCCAGGCCCTGCCCAGCCAAGACGAAGGCCCCA
GCAAGGCCTTCGTGAACTGTGACGAGAACAGCCGGCTTGTCTCCCTGACCCTGAACCTGGTGACCAGGGC
TGATGAGGGCTGGTACTGGTGTGGAGTGAAGCAGGGCCACTTCTATGGAGAGACTGCAGCCGTCTATGTG
GCAGTTGAAGAGAGGAAGGCAGCGGGGTCCCGCGATGTCAGCCTAGCGAAGGCAGACGCTGCTCCTGATG
AGAAGGTGCTAGACTCTGGTTTTCGGGAGATTGAGAACAAAGCCATTCAGGATCCCAGGCTTTTTGCAGA
GGAAAAGGCGGTGGCAGATACAAGAGATCAAGCCGATGGGAGCAGAGCATCTGTGGATTCCGGCAGCTCT
GAGGAACAAGGTGGAAGCTCCAGAGCGCTGGTCTCCACCCTGGTGCCCCTGGGCCTGGTGCTGGCAGTGG
GAGCCGTGGCTGTGGGGGTGGCCAGAGCCCGGCACAGGAAGAACGTCGACCGAGTTTCAATCAGAAGCTA
CAGGACAGACATTAGCATGTCAGACTTCGAGAACTCCAGGGAATTTGGAGCCAATGACAACATGGGAGCC
TCTTCGATCACTCAGGAGACATCCCTCGGAGGAAAAGAAGAGTTTGTTGCCACCACTGAGAGCACCACAG
AGACCAAAGAACCCAAGAAGGCAAAAAGGTCATCCAAGGAGGAAGCCGAGATGGCCTACAAAGACTTCCT
GCTCCAGTCCAGCACCGTGGCCGCCGAGGCCCAGGACGGCCCCCAGGAAGCC


ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT
ACAAGGATGACGACGATAAG
GTTTAA
>RC212006 representing NM_002644
Red=Cloning site Green=Tags(s)

MLLFVLTCLLAVFPAISTKSPIFGPEEVNSVEGNSVSITCYYPPTSVNRHTRKYWCRQGARGGCITLISS
EGYVSSKYAGRANLTNFPENGTFVVNIAQLSQDDSGRYKCGLGINSRGLSFDVSLEVSQGPGLLNDTKVY
TVDLGRTVTINCPFKTENAQKRKSLYKQIGLYPVLVIDSSGYVNPNYTGRIRLDIQGTGQLLFSVVINQL
RLSDAGQYLCQAGDDSNSNKKNADLQVLKPEPELVYEDLRGSVTFHCALGPEVANVAKFLCRQSSGENCD
VVVNTLGKRAPAFEGRILLNPQDKDGSFSVVITGLRKEDAGRYLCGAHSDGQLQEGSPIQAWQLFVNEES
TIPRSPTVVKGVAGGSVAVLCPYNRKESKSIKYWCLWEGAQNGRCPLLVDSEGWVKAQYEGRLSLLEEPG
NGTFTVILNQLTSRDAGFYWCLTNGDTLWRTTVEIKIIEGEPNLKVPGNVTAVLGETLKVPCHFPCKFSS
YEKYWCKWNNTGCQALPSQDEGPSKAFVNCDENSRLVSLTLNLVTRADEGWYWCGVKQGHFYGETAAVYV
AVEERKAAGSRDVSLAKADAAPDEKVLDSGFREIENKAIQDPRLFAEEKAVADTRDQADGSRASVDSGSS
EEQGGSSRALVSTLVPLGLVLAVGAVAVGVARARHRKNVDRVSIRSYRTDISMSDFENSREFGANDNMGA
SSITQETSLGGKEEFVATTESTTETKEPKKAKRSSKEEAEMAYKDFLLQSSTVAAEAQDGPQEA

myc-FLAG tag
Chromatograms CHROMATOGRAMS
Sequencher program is needed, download here.
Restriction Sites SgfI-MluI      Cloning Scheme for this gene      Plasmid Map     
ACCN NM_002644
ORF Size 2292 bp
OTI Disclaimer The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Product Components The ORF clone is ion-exchange column purified and shipped in a 2D barcoded Matrix tube containing 10ug of transfection-ready, dried plasmid DNA (reconstitute with 100 ul of water).
Reconstitution 1. Centrifuge at 5,000xg for 5min.
2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA.
3. Close the tube and incubate for 10 minutes at room temperature.
4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom.
5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C.
Reference Data
RefSeq NM_002644.4
RefSeq Size 4266 bp
RefSeq ORF 2295 bp
Locus ID 5284
UniProt ID P01833
Cytogenetics 1q32.1
Domains ig, IGv, IG
Protein Families Druggable Genome, Secreted Protein, Transmembrane
MW 83.28 kDa
Gene Summary This gene is a member of the immunoglobulin superfamily. The encoded poly-Ig receptor binds polymeric immunoglobulin molecules at the basolateral surface of epithelial cells; the complex is then transported across the cell to be secreted at the apical surface. A significant association was found between immunoglobulin A nephropathy and several SNPs in this gene.[provided by RefSeq, Sep 2009]
Customer Reviews 
Loading...
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.