E2 230K (UBE2O) (NM_022066) Human Tagged ORF Clone

CAT#: RC211950

Reviews ()
Write a review

UBE2O (Myc-DDK-tagged)-Human ubiquitin-conjugating enzyme E2O (UBE2O)



  "NM_022066" in other vectors (7)

Reconstitution Protocol

Special Offer: 20% off the control vector (empty cloning vector without insert). Use code "Shuttle20".

USD 1,125.00


Availability*
In Stock

Size
    • 10 ug


Product images

Other products for "UBE2O"

Specifications

Product Data
Type Human Tagged ORF Clone
Tag Myc-DDK
Symbol UBE2O
Synonyms E2-230K
Vector pCMV6-Entry
E. coli Selection Kanamycin (25 ug/mL)
Mammalian Cell Selection Neomycin
Sequence Data
>RC211950 representing NM_022066
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGGCGGATCCCGCAGCCCCCACGCCCGCAGCTCCCGCTCCAGCCCAGGCCCCGGCTCCAGCCCCGGAGG
CAGTCCCGGCCCCAGCCGCAGCCCCCGTCCCGGCGCCGGCGCCCGCCTCGGACTCGGCCTCCGGGCCGTC
CTCGGACTCCGGCCCAGAAGCCGGCTCGCAGCGCCTGCTGTTTTCTCACGACCTGGTGTCGGGCCGTTAC
CGTGGCTCCGTGCACTTCGGGCTGGTGCGCCTCATCCACGGCGAGGACTCGGACTCGGAGGGCGAGGAGG
AGGGCCGCGGGAGCTCGGGGTGCTCCGAGGCCGGGGGCGCGGGCCACGAGGAGGGCCGGGCCAGCCCCCT
GCGCCGCGGCTACGTGCGCGTCCAGTGGTACCCGGAGGGCGTCAAGCAGCATGTGAAGGAGACCAAGCTG
AAACTAGAGGACCGTTCTGTGGTGCCCCGAGATGTGGTCCGGCACATGCGATCCACCGACAGTCAGTGTG
GCACGGTGATCGACGTCAACATCGACTGTGCCGTCAAGCTCATCGGCACCAACTGCATCATCTATCCCGT
CAACAGCAAGGACCTGCAGCACATCTGGCCCTTCATGTATGGGGACTACATTGCCTATGACTGCTGGCTG
GGGAAGGTCTACGACTTGAAGAACCAGATCATCCTGAAGCTATCCAACGGCGCCAGGTGCTCCATGAACA
CGGAAGATGGCGCCAAGCTCTACGACGTCTGCCCGCACGTCAGCGACTCGGGTCTCTTCTTCGATGATTC
CTATGGCTTCTACCCAGGCCAGGTGCTCATTGGCCCTGCCAAGATCTTCTCCAGCGTCCAGTGGCTGTCA
GGTGTCAAGCCCGTGCTCAGCACCAAGAGCAAGTTCCGAGTGGTGGTGGAAGAGGTGCAGGTTGTAGAGT
TGAAAGTTACATGGATTACCAAGAGTTTCTGTCCAGGGGGCACGGACAGCGTCAGCCCCCCACCCTCTGT
CATCACCCAGGAAAACCTAGGCAGGGTGAAGCGTCTCGGATGCTTTGACCATGCTCAGCGGCAGCTTGGG
GAGCGCTGTCTGTATGTCTTCCCAGCCAAGGTAGAGCCAGCCAAGATTGCCTGGGAATGTCCAGAAAAAA
ACTGCGCCCAGGGGGAGGGCTCTATGGCCAAGAAGGTGAAGCGCCTGTTGAAGAAGCAGGTTGTGCGGAT
CATGTCATGCTCCCCAGACACCCAGTGTTCCCGGGACCATTCCATGGAAGACCCAGACAAGAAGGGGGAA
TCCAAAACCAAGAGCGAAGCGGAGTCTGCCAGCCCTGAGGAGACGCCCGATGGCTCTGCCAGTCCAGTGG
AGATGCAGGACGAGGGTGCAGAGGAGCCCCACGAGGCAGGAGAGCAGCTGCCCCCATTCCTGCTAAAAGA
AGGCAGAGATGACAGGCTGCACTCGGCAGAGCAGGACGCAGATGATGAGGCTGCTGATGACACGGACGAC
ACCAGTTCGGTGACCTCCTCTGCCAGCTCCACCACTTCCTCCCAGAGCGGCAGCGGCACGAGTCGCAAAA
AGAGCATCCCCTTGTCCATCAAGAACTTAAAGCGCAAACACAAGAGGAAGAAGAATAAAATCACTCGAGA
CTTCAAGCCAGGGGACAGGGTGGCAGTGGAGGTGGTGACCACGATGACCTCAGCCGACGTGATGTGGCAG
GATGGCTCCGTGGAATGCAACATCCGCTCCAACGACCTCTTCCCTGTGCACCACCTGGACAACAACGAGT
TCTGCCCTGGAGACTTCGTGGTAGATAAGCGAGTCCAGAGCTGTCCAGACCCTGCTGTCTACGGTGTGGT
ACAGTCTGGGGACCACATCGGCCGTACCTGCATGGTGAAGTGGTTCAAGCTGAGGCCGAGTGGGGACGAC
GTGGAGCTGATTGGAGAAGAGGAAGATGTGAGTGTTTACGACATTGCTGACCACCCTGACTTTAGGTTCC
GTACAACTGACATCGTCATCCGCATCGGCAATACTGAGGATGGGGCTCCTCACAAGGAGGATGAGCCATC
GGTGGGCCAGGTGGCCCGTGTGGACGTCAGCAGCAAGGTGGAGGTGGTGTGGGCTGACAACTCAAAGACC
ATCATCCTGCCCCAGCACTTGTACAACATAGAGTCTGAGATTGAGGAGTCAGACTACGATTCGGTAGAAG
GCAGCACCAGCGGGGCATCCTCGGATGAATGGGAAGATGATAGTGACAGCTGGGAGACGGACAATGGGCT
GGTGGAGGACGAGCACCCCAAGATAGAGGAGCCCCCCATCCCACCCCTGGAGCAGCCGGTGGCCCCTGAG
GACAAGGGAGTGGTGATCAGTGAAGAGGCAGCCACAGCTGCCGTCCAGGGGGCTGTGGCCATGGCTGCCC
CCATGGCCGGGCTGATGGAGAAGGCTGGCAAGGACGGGCCACCCAAGAGCTTCCGGGAGTTGAAAGAGGC
CATCAAGATCCTGGAGAGCCTCAAGAACATGACTGTGGAGCAGCTGCTGACGGGCTCGCCCACCTCTCCG
ACTGTGGAGCCTGAGAAGCCAACTCGGGAGAAGAAGTTTCTGGATGACATCAAGAAGCTACAGGAAAACC
TCAAGAAGACCCTGGACAATGTGGCCATTGTAGAGGAGGAGAAGATGGAAGCAGTGCCCGACGTAGAGCG
CAAGGAGGACAAGCCCGAGGGGCAGTCACCTGTGAAGGCTGAGTGGCCCAGCGAAACCCCGGTGCTGTGC
CAGCAGTGTGGCGGCAAGCCTGGCGTCACCTTCACCAGCGCCAAGGGCGAGGTCTTCTCCGTACTGGAGT
TTGCACCCTCAAATCATTCTTTTAAGAAAATTGAGTTCCAGCCTCCAGAAGCCAAGAAGTTCTTCAGCAC
AGTGCGGAAGGAGATGGCGCTGCTGGCTACCTCACTGCCTGAGGGCATCATGGTCAAGACTTTTGAAGAT
AGAATGGACCTCTTCTCAGCTCTCATCAAGGGCCCCACTCGAACCCCCTACGAGGATGGCCTCTACTTGT
TTGACATCCAGCTCCCCAACATCTACCCAGCCGTGCCCCCCCACTTCTGCTACCTCTCCCAATGCAGTGG
CCGCCTGAACCCCAACCTGTATGACAATGGGAAGGTGTGTGTCAGCCTCCTGGGCACCTGGATTGGAAAG
GGGACAGAGAGGTGGACAAGCAAGTCCAGCCTTCTCCAGGTGCTCATCTCCATCCAAGGTCTGATCCTGG
TAAATGAACCATACTACAACGAAGCCGGCTTCGACAGTGACCGAGGCCTGCAGGAAGGCTATGAAAACAG
TCGCTGTTACAATGAGATGGCGCTGATCCGCGTGGTGCAGTCCATGACCCAGCTGGTGCGGCGGCCCCCC
GAGGTCTTTGAGCAGGAGATCAGGCAACACTTTAGCACTGGTGGCTGGCGGCTGGTGAACCGTATCGAGT
CCTGGCTGGAAACCCATGCCCTGCTGGAGAAGGCCCAGGCACTGCCCAACGGGGTGCCCAAGGCCAGCAG
CTCGCCAGAGCCCCCAGCTGTAGCCGAGCTGTCAGACTCCGGCCAACAAGAACCTGAGGATGGAGGGCCA
GCCCCAGGAGAGGCCTCCCAGGGCTCAGACTCAGAGGGCGGTGCCCAGGGCCTGGCCTCAGCTAGCAGGG
ACCACACAGACCAGACTTCGGAGACCGCACCAGACGCATCGGTGCCACCCAGTGTGAAACCAAAGAAGCG
GAGAAAGAGCTACCGGAGCTTCTTACCTGAGAAGAGTGGCTACCCTGACATCGGCTTCCCCCTCTTCCCA
CTTTCCAAGGGTTTCATCAAGAGCATCCGGGGTGTCCTGACGCAGTTCCGGGCTGCCCTGCTAGAGGCAG
GCATGCCGGAGTGCACAGAGGACAAG


ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT
ACAAGGATGACGACGATAAG
GTTTAA
>RC211950 representing NM_022066
Red=Cloning site Green=Tags(s)

MADPAAPTPAAPAPAQAPAPAPEAVPAPAAAPVPAPAPASDSASGPSSDSGPEAGSQRLLFSHDLVSGRY
RGSVHFGLVRLIHGEDSDSEGEEEGRGSSGCSEAGGAGHEEGRASPLRRGYVRVQWYPEGVKQHVKETKL
KLEDRSVVPRDVVRHMRSTDSQCGTVIDVNIDCAVKLIGTNCIIYPVNSKDLQHIWPFMYGDYIAYDCWL
GKVYDLKNQIILKLSNGARCSMNTEDGAKLYDVCPHVSDSGLFFDDSYGFYPGQVLIGPAKIFSSVQWLS
GVKPVLSTKSKFRVVVEEVQVVELKVTWITKSFCPGGTDSVSPPPSVITQENLGRVKRLGCFDHAQRQLG
ERCLYVFPAKVEPAKIAWECPEKNCAQGEGSMAKKVKRLLKKQVVRIMSCSPDTQCSRDHSMEDPDKKGE
SKTKSEAESASPEETPDGSASPVEMQDEGAEEPHEAGEQLPPFLLKEGRDDRLHSAEQDADDEAADDTDD
TSSVTSSASSTTSSQSGSGTSRKKSIPLSIKNLKRKHKRKKNKITRDFKPGDRVAVEVVTTMTSADVMWQ
DGSVECNIRSNDLFPVHHLDNNEFCPGDFVVDKRVQSCPDPAVYGVVQSGDHIGRTCMVKWFKLRPSGDD
VELIGEEEDVSVYDIADHPDFRFRTTDIVIRIGNTEDGAPHKEDEPSVGQVARVDVSSKVEVVWADNSKT
IILPQHLYNIESEIEESDYDSVEGSTSGASSDEWEDDSDSWETDNGLVEDEHPKIEEPPIPPLEQPVAPE
DKGVVISEEAATAAVQGAVAMAAPMAGLMEKAGKDGPPKSFRELKEAIKILESLKNMTVEQLLTGSPTSP
TVEPEKPTREKKFLDDIKKLQENLKKTLDNVAIVEEEKMEAVPDVERKEDKPEGQSPVKAEWPSETPVLC
QQCGGKPGVTFTSAKGEVFSVLEFAPSNHSFKKIEFQPPEAKKFFSTVRKEMALLATSLPEGIMVKTFED
RMDLFSALIKGPTRTPYEDGLYLFDIQLPNIYPAVPPHFCYLSQCSGRLNPNLYDNGKVCVSLLGTWIGK
GTERWTSKSSLLQVLISIQGLILVNEPYYNEAGFDSDRGLQEGYENSRCYNEMALIRVVQSMTQLVRRPP
EVFEQEIRQHFSTGGWRLVNRIESWLETHALLEKAQALPNGVPKASSSPEPPAVAELSDSGQQEPEDGGP
APGEASQGSDSEGGAQGLASASRDHTDQTSETAPDASVPPSVKPKKRRKSYRSFLPEKSGYPDIGFPLFP
LSKGFIKSIRGVLTQFRAALLEAGMPECTEDK

myc-FLAG tag
Chromatograms CHROMATOGRAMS
Sequencher program is needed, download here.
Restriction Sites SgfI-MluI      Cloning Scheme for this gene      Plasmid Map     
ACCN NM_022066
ORF Size 3876 bp
OTI Disclaimer The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Product Components The ORF clone is ion-exchange column purified and shipped in a 2D barcoded Matrix tube containing 10ug of transfection-ready, dried plasmid DNA (reconstitute with 100 ul of water).
Reconstitution 1. Centrifuge at 5,000xg for 5min.
2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA.
3. Close the tube and incubate for 10 minutes at room temperature.
4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom.
5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C.
Reference Data
RefSeq NM_022066.4
RefSeq Size 5073 bp
RefSeq ORF 3879 bp
Locus ID 63893
UniProt ID Q9C0C9
Cytogenetics 17q25.1
Domains UBCc
Protein Pathways Ubiquitin mediated proteolysis
MW 141.1 kDa
Gene Summary E2/E3 hybrid ubiquitin-protein ligase that displays both E2 and E3 ligase activities and mediates monoubiquitination of target proteins (PubMed:23455153, PubMed:24703950). Negatively regulates TRAF6-mediated NF-kappa-B activation independently of its E2 activity (PubMed:23381138). Acts as a positive regulator of BMP7 signaling by mediating monoubiquitination of SMAD6, thereby regulating adipogenesis (PubMed:23455153). Mediates monoubiquitination at different sites of the nuclear localization signal (NLS) of BAP1, leading to cytoplasmic retention of BAP1. Also able to monoubiquitinate the NLS of other chromatin-associated proteins, such as INO80 and CXXC1, affecting their subcellular location (PubMed:24703950). Acts as a regulator of retrograde transport by assisting the TRIM27:MAGEL2 E3 ubiquitin ligase complex to mediate 'Lys-63'-linked ubiquitination of WASHC1, leading to promote endosomal F-actin assembly (PubMed:23452853).[UniProtKB/Swiss-Prot Function]

Other Versions

Frequently bought together (4)
Clone OTI4C5, Anti-DDK (FLAG) monoclonal antibody
    • 30 ul

USD 177.00


pCMV6-Entry, mammalian vector with C-terminal Myc- DDK Tag, 10ug
    • 10 ug

USD 650.00


DH5α Chemically Competent Cells (≥10^8 cfu/μg of pUC19 DNA)
    • 5 x 200 ul

USD 160.00


Forward sequencing primer VP1.5, Reverse sequencing primer XL39, 100pmoles each
    • 100 pmol

USD 59.00

Customer Reviews 
Loading...
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.