GJC1(GJC1) (NM_005497) Human Tagged ORF Clone

CAT#: RC211939

GJC1 (Myc-DDK-tagged)-Human gap junction protein, gamma 1, 45kDa (GJC1), transcript variant 1

Clone Modification / Custom Cloning Service

  • TrueORF®

USD 505.00


Availability*
2 Weeks

Size
    • 10 ug

Product images

Specifications

Product Data
Product Name GJC1(GJC1) (NM_005497) Human Tagged ORF Clone
Symbol GJC1
Synonyms CX45; GJA7
Vector pCMV6-Entry
Sequence Data
ORF Nucleotide Sequence
>RC211939 representing NM_005497
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGAGTTGGAGCTTCCTGACTCGCCTGCTAGAGGAGATTCACAACCATTCCACATTTGTGGGGAAGATCT
GGCTCACTGTTCTGATTGTCTTCCGGATCGTCCTTACAGCTGTAGGAGGAGAATCCATCTATTACGATGA
GCAAAGCAAATTTGTGTGCAACACAGAACAGCCGGGCTGTGAGAATGTCTGTTATGATGCGTTTGCACCT
CTCTCCCATGTACGCTTCTGGGTGTTCCAGATCATCCTGGTGGCAACTCCCTCTGTGATGTACCTGGGCT
ATGCTATCCACAAGATTGCCAAAATGGAGCACGGTGAAGCAGACAAGAAGGCAGCTCGGAGCAAGCCCTA
TGCAATGCGCTGGAAACAACACCGGGCTCTGGAAGAAACGGAGGAGGACAACGAAGAGGATCCTATGATG
TATCCAGAGATGGAGTTAGAAAGTGATAAGGAAAATAAAGAGCAGAGCCAACCCAAACCTAAGCATGATG
GCCGACGACGGATTCGGGAAGATGGGCTCATGAAAATCTATGTGCTGCAGTTGCTGGCAAGGACCGTGTT
TGAGGTGGGTTTTCTGATAGGGCAGTATTTTCTGTATGGCTTCCAAGTCCACCCGTTTTATGTGTGCAGC
AGACTTCCTTGTCCTCATAAGATAGACTGCTTTATTTCTAGACCCACTGAAAAGACCATCTTCCTTCTGA
TAATGTATGGTGTTACAGGCCTTTGCCTCTTGCTTAACATTTGGGAGATGCTTCATTTAGGGTTTGGGAC
CATTCGAGACTCACTAAACAGTAAAAGGAGGGAACTTGAGGATCCGGGTGCTTATAATTATCCTTTCACT
TGGAATACACCATCTGCTCCCCCTGGCTATAACATTGCTGTCAAACCAGATCAAATCCAGTACACCGAAC
TGTCCAATGCTAAGATCGCCTACAAGCAAAACAAGGCCAACACAGCCCAGGAACAGCAGTATGGCAGCCA
TGAGGAGAACCTCCCAGCTGACCTGGAGGCTCTGCAGCGGGAGATCAGGATGGCTCAGGAACGCTTGGAT
CTGGCAGTTCAGGCCTACAGTCACCAAAACAACCCTCATGGTCCCCGGGAGAAGAAGGCCAAAGTGGGGT
CCAAAGCTGGGTCCAACAAAAGCACTGCCAGTAGCAAATCAGGGGATGGGAAGACCTCCGCTGGATT


ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT
ACAAGGATGACGACGATAAG
GTTTAA
Protein Sequence
>RC211939 representing NM_005497
Red=Cloning site Green=Tags(s)

MSWSFLTRLLEEIHNHSTFVGKIWLTVLIVFRIVLTAVGGESIYYDEQSKFVCNTEQPGCENVCYDAFAP
LSHVRFWVFQIILVATPSVMYLGYAIHKIAKMEHGEADKKAARSKPYAMRWKQHRALEETEEDNEEDPMM
YPEMELESDKENKEQSQPKPKHDGRRRIREDGLMKIYVLQLLARTVFEVGFLIGQYFLYGFQVHPFYVCS
RLPCPHKIDCFISRPTEKTIFLLIMYGVTGLCLLLNIWEMLHLGFGTIRDSLNSKRRELEDPGAYNYPFT
WNTPSAPPGYNIAVKPDQIQYTELSNAKIAYKQNKANTAQEQQYGSHEENLPADLEALQREIRMAQERLD
LAVQAYSHQNNPHGPREKKAKVGSKAGSNKSTASSKSGDGKTSAG

myc-FLAG tag
Chromatograms CHROMATOGRAMS
Sequencher program is needed, download here.
Restriction Sites SgfI-MluI      Cloning Scheme for this gene      Plasmid Map     
Tag Myc-DDK
ACCN NM_005497
ORF Size 1187 bp
OTI Disclaimer The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Product Components The ORF clone is ion-exchange column purified, transfection-ready dried plasmid DNA, and shipped with 2 vector sequencing primers.
Reference Data
RefSeq NM_005497.2, NM_005497.3, NP_005488
RefSeq Size 1889
RefSeq ORF 1191
Locus ID 10052
Cytogenetics 17q21.31
Domains CNX
Protein Families Ion Channels: Other, Transmembrane
MW 45.3 kDa
Gene Summary This gene is a member of the connexin gene family. The encoded protein is a component of gap junctions, which are composed of arrays of intercellular channels that provide a route for the diffusion of low molecular weight materials from cell to cell. Alternatively spliced transcript variants encoding the same isoform have been described. [provided by RefSeq, Jul 2008].
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Citations (1)