Glucuronic Acid Epimerase(GLCE) (NM_015554) Human Tagged ORF Clone

CAT#: RC211866

GLCE (Myc-DDK-tagged)-Human glucuronic acid epimerase (GLCE)

  • TrueORF®

Need custom modification / cloning service?
Get a free quote

USD 783.00


Availability*
In Stock

Size
    • 10 ug

Cited in 1 publication.

Product images

Specifications

Product Data
Product Name Glucuronic Acid Epimerase(GLCE) (NM_015554) Human Tagged ORF Clone
Symbol GLCE
Synonyms HSEPI; HSEPI
Vector pCMV6-Entry
Sequence Data
>RC211866 representing NM_015554
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGCGTTGCTTGGCAGCTCGGGTCAACTATAAGACTTTGATTATTATCTGCGCACTCTTCACTTTGGTCA
CAGTACTTTTGTGGAATAAGTGTTCCAGTGACAAAGCAATCCAGTTTCCACGGCGTTCGAGTAGTGGCTT
CAGAGTGGATGGGTTTGAAAAAAGAGCAGCAGCATCTGAGAGTAACAACTATATGAACCACGTGGCCAAA
CAACAGTCTGAGGAAGCATTCCCTCAGGAACAGCAGAAAGCACCCCCTGTTGTTGGGGGCTTCAATAGCA
ATGTGGGAAGTAAGGTGTTAGGGCTCAAATATGAAGAAATTGACTGTCTCATAAATGATGAACACACAAT
TAAAGGGAGACGAGAGGGGAACGAAGTCTTTCTTCCATTCACTTGGGTTGAGAAATATTTTGATGTTTAT
GGAAAGGTGGTTCAGTATGATGGCTATGATCGGTTTGAATTCTCTCATAGCTATTCCAAAGTCTATGCAC
AGAGAGCCCCCTATCACCCCGATGGTGTGTTTATGTCTTTTGAAGGCTACAATGTGGAAGTCCGAGACAG
AGTCAAGTGCATAAGTGGGGTTGAAGGTGTGCCATTATCTACACAATGGGGACCTCAAGGCTATTTCTAT
CCAATCCAGATTGCACAGTATGGATTAAGTCATTACAGCAAGAATCTAACTGAGAAACCTCCTCACATAG
AGGTATATGAAACAGCAGAAGACAGAGACAAAAACAAGCCTAATGACTGGACTGTGCCAAAGGGCTGCTT
TATGGCGAATGTGGCTGATAAGTCTAGATTCACCAATGTCAAACAGTTTATTGCACCAGAAACCAGTGAA
GGTGTATCCTTGCAACTGGGAAACACAAAAGATTTTATTATTTCATTTGACCTCAAGTTCTTGACAAATG
GAAGTGTGTCCGTGGTTCTAGAGACCACAGAAAAGAATCAGCTCTTCACTATACATTATGTCTCAAATGC
TCAGCTAATTGCTTTTAAAGAAAGAGATATATACTATGGCATTGGGCCCAGAACTTCATGGAGCACAGTT
ACCAGGGACCTGGTCACTGACCTCAGGAAAGGAGTGGGTCTTTCAAACACAAAAGCTGTCAAGCCAACCA
AAATAATGCCCAAGAAGGTGGTTAGGTTGATTGCAAAAGGTAAGGGATTCCTCGACAACATTACCATCTC
TACCACAGCCCACATGGCTGCATTTTTTGCTGCTAGTGATTGGCTAGTAAGGAACCAGGATGAGAAAGGT
GGCTGGCCAATTATGGTGACCCGTAAGTTAGGGGAAGGGTTCAAGTCTTTAGAGCCAGGATGGTATTCTG
CCATGGCCCAAGGGCAAGCCATTTCTACATTAGTCAGGGCCTATCTGTTAACAAAAGACCATATATTCCT
CAATTCAGCTTTAAGGGCAACAGCCCCTTATAAGTTTCTATCTGAGCAGCATGGAGTTAAAGCTGTGTTT
ATGAATAAACATGACTGGTATGAAGAATATCCAACCACACCTAGCTCTTTTGTTTTAAATGGCTTTATGT
ATTCTTTAATTGGGCTGTATGACTTAAAAGAAACTGCAGGGGAAAAACTCGGAAAAGAAGCAAGGTCCTT
GTATGAGCGTGGCATGGAATCTCTTAAAGCCATGCTGCCCTTGTATGACACTGGCTCAGGAACCATCTAT
GACCTCCGTCACTTCATGCTTGGCATCGCTCCTAACCTGGCTCGCTGGGACTATCATACCACCCACATCA
ATCAGTTGCAGCTACTCAGTACCATTGATGAGTCCCCAGTCTTCAAAGAATTTGTCAAGAGGTGGAAAAG
CTACCTTAAAGGCAGCAGGGCAAAGCACAAC


ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT
ACAAGGATGACGACGATAAG
GTTTAA
>RC211866 representing NM_015554
Red=Cloning site Green=Tags(s)

MRCLAARVNYKTLIIICALFTLVTVLLWNKCSSDKAIQFPRRSSSGFRVDGFEKRAAASESNNYMNHVAK
QQSEEAFPQEQQKAPPVVGGFNSNVGSKVLGLKYEEIDCLINDEHTIKGRREGNEVFLPFTWVEKYFDVY
GKVVQYDGYDRFEFSHSYSKVYAQRAPYHPDGVFMSFEGYNVEVRDRVKCISGVEGVPLSTQWGPQGYFY
PIQIAQYGLSHYSKNLTEKPPHIEVYETAEDRDKNKPNDWTVPKGCFMANVADKSRFTNVKQFIAPETSE
GVSLQLGNTKDFIISFDLKFLTNGSVSVVLETTEKNQLFTIHYVSNAQLIAFKERDIYYGIGPRTSWSTV
TRDLVTDLRKGVGLSNTKAVKPTKIMPKKVVRLIAKGKGFLDNITISTTAHMAAFFAASDWLVRNQDEKG
GWPIMVTRKLGEGFKSLEPGWYSAMAQGQAISTLVRAYLLTKDHIFLNSALRATAPYKFLSEQHGVKAVF
MNKHDWYEEYPTTPSSFVLNGFMYSLIGLYDLKETAGEKLGKEARSLYERGMESLKAMLPLYDTGSGTIY
DLRHFMLGIAPNLARWDYHTTHINQLQLLSTIDESPVFKEFVKRWKSYLKGSRAKHN

myc-FLAG tag
Chromatograms CHROMATOGRAMS
Sequencher program is needed, download here.
Restriction Sites SgfI-MluI      Cloning Scheme for this gene      Plasmid Map     
Tag Myc-DDK
ACCN NM_015554
ORF Size 1851 bp
OTI Disclaimer The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Product Components The ORF clone is ion-exchange column purified, transfection-ready dried plasmid DNA, and shipped with 2 vector sequencing primers.
Reference Data
RefSeq NM_015554.1, NM_015554.2, NP_056369
RefSeq Size 5043
RefSeq ORF 1854
Locus ID 26035
Cytogenetics 15q23
Protein Families Transmembrane
Protein Pathways Heparan sulfate biosynthesis, Metabolic pathways
MW 69.9 kDa
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Citations (1)