Calpastatin (CAST) (NM_001750) Human Tagged ORF Clone

CAT#: RC211776

Reviews ()
Write a review

CAST (Myc-DDK-tagged)-Human calpastatin (CAST), transcript variant 1



  "NM_001750" in other vectors (7)

Special Offer: 20% off the control vector (empty cloning vector without insert). Use code "Shuttle20".

USD 691.00


Availability*
In Stock

Size
    • 10 ug


Product images

Specifications

Product Data
Type Human Tagged ORF Clone
Tag Myc-DDK
Symbol CAST
Synonyms BS-17; PLACK
Vector pCMV6-Entry
E. coli Selection Kanamycin (25 ug/mL)
Mammalian Cell Selection Neomycin
Sequence Data
>RC211776 representing NM_001750
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGTCCCAGCCCGGCCAGAAGCCCGCCGCCTCCCCGCGGCCCCGGCGAGCAGCCGCCGCCCGCCGCACCC
ATGAGCATGTCAGTGAAAAAACCAGTGAATCGCCTTCCAAACCAGGAGAAAAGAAAGGATCAGATGAGAA
AAAAGCAGCAAGCCTCGGCAGCAGTCAATCCTCCAGAACCTATGCTGGTGGAACAGCCTCGGCCACCAAG
GTGTCAGCTTCCTCTGGTGCAACCAGCAAGTCTTCCAGTATGAATCCCACAGAAACCAAGGCCATTCCAG
TCAGCCAACAGATGGAAGGACCACATCTTCCTAACAAGAAAAAACACAAAAAACAGGCTGTAAAAACAGA
ACCTGAGAAGAAGTCACAGTCAACCAAGCTGTCTGTGGTTCATGAGAAAAAATCCCAAGAAGGAAAGCCA
AAAGAACACACAGAGCCAAAAAGCCTACCCAAGCAGGCATCAGATACAGGAAGTAACGATGCTCACAATA
AAAAAGCAGTTTCCAGATCAGCTGAACAGCAGCCATCAGAGAAATCAACAGAACCAAAGACTAAACCACA
AGACATGATTTCTGCTGGTGGAGAGAGTGTTGCTGGTATCACTGCAATATCTGGCAAGCCGGGTGACAAG
AAAAAAGAAAAGAAATCATTAACCCCAGCTGTGCCAGTTGAATCTAAACCGGATAAACCATCGGGAAAGT
CAGGCATGGATGCTGCTTTGGATGACTTAATAGATACTTTAGGAGGACCTGAAGAAACTGAAGAAGAAAA
TACAACGTATACTGGACCAGAAGTTTCAGATCCAATGAGTTCCACCTACATAGAGGAATTGGGTAAAAGA
GAAGTCACAATTCCTCCAAAATATAGGGAACTATTGGCTAAAAAGGAAGGGATCACAGGGCCTCCTGCAG
ACTCTTCGAAACCCATAGGGCCAGATGATGCTATAGACGCCTTGTCATCTGACTTCACCTGTGGGTCGCC
TACAGCTGCTGGAAAGAAAACTGAAAAAGAGGAATCTACAGAAGTTTTAAAAGCTCAGTCATCAGGGACA
GTCAGAAGTGCTGCTCCACCCCAAGAGAAGAAAAGAAAGGTGGAGAAGGATACAATGAGTGATCAAGCAC
TCGAGGCTCTGTCGGCTTCACTGGGCACCCGGCAAGCAGAACCTGAGCTCGACCTCCGCTCAATTAAGGA
AGTCGATGAGGCAAAAGCTAAAGAAGAAAAACTAGAGAAGTGTGGTGAGGATGATGAAACAATCCCATCT
GAGTACAGATTAAAACCAGCCACGGATAAAGATGGAAAACCACTATTGCCAGAGCCTGAAGAAAAACCCA
AGCCTCGGAGTGAATCAGAACTCATTGATGAACTTTCAGAAGATTTTGACCGGTCTGAATGTAAAGAGAA
ACCATCTAAGCCAACTGAAAAGACAGAAGAATCTAAGGCCGCTGCTCCAGCTCCTGTGTCGGAGGCTGTG
TGTCGGACCTCCATGTGTAGTATACAGTCAGCACCCCCTGAGCCGGCTACCTTGAAGGGCACAGTGCCAG
ATGATGCTGTAGAAGCCTTGGCTGATAGCCTGGGGAAAAAGGAAGCAGATCCAGAAGATGGAAAACCTGT
GATGGATAAAGTCAAGGAGAAGGCCAAAGAAGAAGACCGTGAAAAGCTTGGTGAAAAAGAAGAAACAATT
CCTCCTGATTATAGATTAGAAGAGGTCAAGGATAAAGATGGAAAGCCACTCCTGCCAAAAGAGTCTAAGG
AACAGCTTCCACCCATGAGTGAAGACTTCCTTCTGGATGCTTTGTCTGAGGACTTCTCTGGTCCACAAAA
TGCTTCATCTCTTAAATTTGAAGATGCTAAACTTGCTGCTGCCATCTCTGAAGTGGTTTCCCAAACCCCA
GCTTCAACGACCCAAGCTGGAGCCCCACCCCGTGATACCTCGCAGAGTGACAAAGACCTCGATGATGCCT
TGGATAAACTCTCTGACAGTCTAGGACAAAGGCAGCCTGACCCAGATGAGAACAAACCAATGGAAGATAA
AGTAAAGGAAAAAGCTAAAGCTGAACATAGAGACAAGCTTGGAGAAAGAGATGACACTATCCCACCTGAA
TACAGACATCTCCTGGATGATAATGGACAGGACAAACCAGTGAAGCCACCTACAAAGAAATCAGAGGATT
CAAAGAAACCTGCAGATGACCAAGACCCCATTGATGCTCTCTCAGGAGATCTGGACAGCTGTCCCTCCAC
TACAGAAACCTCACAGAACACAGCAAAGGATAAGTGCAAGAAGGCTGCTTCCAGCTCCAAAGCACCTAAG
AATGGAGGTAAAGCGAAGGATTCAGCAAAGACAACAGAGGAAACTTCCAAGCCAAAAGATGAC


ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT
ACAAGGATGACGACGATAAG
GTTTAA
>RC211776 representing NM_001750
Red=Cloning site Green=Tags(s)

MSQPGQKPAASPRPRRAAAARRTHEHVSEKTSESPSKPGEKKGSDEKKAASLGSSQSSRTYAGGTASATK
VSASSGATSKSSSMNPTETKAIPVSQQMEGPHLPNKKKHKKQAVKTEPEKKSQSTKLSVVHEKKSQEGKP
KEHTEPKSLPKQASDTGSNDAHNKKAVSRSAEQQPSEKSTEPKTKPQDMISAGGESVAGITAISGKPGDK
KKEKKSLTPAVPVESKPDKPSGKSGMDAALDDLIDTLGGPEETEEENTTYTGPEVSDPMSSTYIEELGKR
EVTIPPKYRELLAKKEGITGPPADSSKPIGPDDAIDALSSDFTCGSPTAAGKKTEKEESTEVLKAQSSGT
VRSAAPPQEKKRKVEKDTMSDQALEALSASLGTRQAEPELDLRSIKEVDEAKAKEEKLEKCGEDDETIPS
EYRLKPATDKDGKPLLPEPEEKPKPRSESELIDELSEDFDRSECKEKPSKPTEKTEESKAAAPAPVSEAV
CRTSMCSIQSAPPEPATLKGTVPDDAVEALADSLGKKEADPEDGKPVMDKVKEKAKEEDREKLGEKEETI
PPDYRLEEVKDKDGKPLLPKESKEQLPPMSEDFLLDALSEDFSGPQNASSLKFEDAKLAAAISEVVSQTP
ASTTQAGAPPRDTSQSDKDLDDALDKLSDSLGQRQPDPDENKPMEDKVKEKAKAEHRDKLGERDDTIPPE
YRHLLDDNGQDKPVKPPTKKSEDSKKPADDQDPIDALSGDLDSCPSTTETSQNTAKDKCKKAASSSKAPK
NGGKAKDSAKTTEETSKPKDD

myc-FLAG tag
Chromatograms CHROMATOGRAMS
Sequencher program is needed, download here.
Restriction Sites SgfI-MluI      Cloning Scheme for this gene      Plasmid Map     
ACCN NM_001750
ORF Size 2373 bp
OTI Disclaimer The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Product Components The ORF clone is ion-exchange column purified and shipped in a 2D barcoded Matrix tube containing 10ug of transfection-ready, dried plasmid DNA (reconstitute with 100 ul of water).
Reconstitution 1. Centrifuge at 5,000xg for 5min.
2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA.
3. Close the tube and incubate for 10 minutes at room temperature.
4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom.
5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C.
Reference Data
RefSeq NM_001750.7
RefSeq Size 4629 bp
RefSeq ORF 2376 bp
Locus ID 831
UniProt ID P20810
Cytogenetics 5q15
Domains Calpain_inhib
MW 84.8 kDa
Gene Summary The protein encoded by this gene is an endogenous calpain (calcium-dependent cysteine protease) inhibitor. It consists of an N-terminal domain L and four repetitive calpain-inhibition domains (domains 1-4), and it is involved in the proteolysis of amyloid precursor protein. The calpain/calpastatin system is involved in numerous membrane fusion events, such as neural vesicle exocytosis and platelet and red-cell aggregation. The encoded protein is also thought to affect the expression levels of genes encoding structural or regulatory proteins. Alternatively spliced transcript variants encoding different isoforms have been described. [provided by RefSeq, Jun 2010]

Other Versions

Other products for "CAST"
Frequently bought together (5)
Clone OTI4C5, Anti-DDK (FLAG) monoclonal antibody
    • 30 ul

USD 165.00


pCMV6-Entry, mammalian vector with C-terminal Myc- DDK Tag, 10ug
    • 10 ug

USD 627.00


CAST (Calpastatin) mouse monoclonal antibody, clone OTI1E7 (formerly 1E7)
    • 100 ul

USD 417.00


DH5α Chemically Competent Cells (≥10^8 cfu/μg of pUC19 DNA)
    • 5 x 200 ul

USD 149.00


Forward sequencing primer VP1.5, Reverse sequencing primer XL39, 100pmoles each
    • 100 pmol

USD 55.00

Customer Reviews 
Loading...
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.