ATP5D (NM_001687) Human Tagged ORF Clone

CAT#: RC211715

ATP5D (Myc-DDK-tagged)-Human ATP synthase, H+ transporting, mitochondrial F1 complex, delta subunit (ATP5D), nuclear gene encoding mitochondrial protein, transcript variant 1

Clone Modification / Custom Cloning Service

USD 98.00

USD 390.00


Availability*
In Stock

Size
    • 10 ug

Product images

Specifications

Product Data
Product Name ATP5D (NM_001687) Human Tagged ORF Clone
Symbol ATP5D
Synonyms mitochondrial ATP synthase complex delta-subunit precusor; mitochondrial ATP synthase, delta subunit; ATP synthase, H+ transporting, mitochondrial F1 complex, delta subunit
Vector pCMV6-Entry
Sequence Data
ORF Nucleotide Sequence
>RC211715 representing NM_001687
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGCTGCCCGCCGCGCTGCTCCGCCGCCCGGGACTTGGCCGCCTCGTCCGCCACGCCCGTGCCTATGCCG
AGGCCGCCGCCGCCCCGGCTGCCGCCTCTGGCCCCAACCAGATGTCCTTCACCTTCGCCTCTCCCACGCA
GGTGTTCTTCAACGGTGCCAACGTCCGGCAGGTGGACGTGCCCACGCTGACCGGAGCCTTCGGCATCCTG
GCGGCCCACGTGCCCACGCTGCAGGTCCTGCGGCCGGGGCTGGTCGTGGTGCATGCAGAGGACGGCACCA
CCTCCAAATACTTTGTGAGCAGCGGTTCCATCGCAGTGAACGCCGACTCTTCGGTGCAGTTGTTGGCCGA
AGAGGCCGTGACGCTGGACATGTTGGACCTGGGGGCAGCCAAGGCAAACTTGGAGAAGGCCCAGGCGGAG
CTGGTGGGGACAGCTGACGAGGCCACGCGGGCAGAGATCCAGATCCGAATCGAGGCCAACGAGGCCCTGG
TGAAGGCCCTGGAG


ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT
ACAAGGATGACGACGATAAG
GTTTAA
Protein Sequence
>RC211715 representing NM_001687
Red=Cloning site Green=Tags(s)

MLPAALLRRPGLGRLVRHARAYAEAAAAPAAASGPNQMSFTFASPTQVFFNGANVRQVDVPTLTGAFGIL
AAHVPTLQVLRPGLVVVHAEDGTTSKYFVSSGSIAVNADSSVQLLAEEAVTLDMLDLGAAKANLEKAQAE
LVGTADEATRAEIQIRIEANEALVKALE

myc-FLAG tag
Chromatograms CHROMATOGRAMS
Sequencher program is needed, download here.
Restriction Sites SgfI-MluI      Cloning Scheme for this gene      Plasmid Map     
Tag Myc-DDK
ACCN NM_001687
ORF Size 504 bp
OTI Disclaimer The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Product Components The ORF clone is ion-exchange column purified, transfection-ready dried plasmid DNA, and shipped with 2 vector sequencing primers.
Reference Data
RefSeq NM_001687.1, NM_001687.2, NM_001687.3, NM_001687.4, NP_001678
RefSeq Size 1005
RefSeq ORF 507
Locus ID 513
Cytogenetics 19p13.3
Domains ATP-synt_DE
Protein Pathways Oxidative phosphorylation, Metabolic pathways, Alzheimer's disease, Parkinson's disease, Huntington's disease
MW 17.49 kDa
Gene Summary This gene encodes a subunit of mitochondrial ATP synthase. Mitochondrial ATP synthase catalyzes ATP synthesis, utilizing an electrochemical gradient of protons across the inner membrane during oxidative phosphorylation. ATP synthase is composed of two linked multi-subunit complexes: the soluble catalytic core, F1, and the membrane-spanning component, Fo, comprising the proton channel. The catalytic portion of mitochondrial ATP synthase consists of 5 different subunits (alpha, beta, gamma, delta, and epsilon) assembled with a stoichiometry of 3 alpha, 3 beta, and a single representative of the other 3. The proton channel consists of three main subunits (a, b, c). This gene encodes the delta subunit of the catalytic core. Alternatively spliced transcript variants encoding the same isoform have been identified. [provided by RefSeq, Jul 2008].
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Citations