ORC4L (ORC4) (NM_181742) Human Tagged ORF Clone

CAT#: RC211713

Reviews ()
Write a review

ORC4 (Myc-DDK-tagged)-Human origin recognition complex, subunit 4 (ORC4), transcript variant 3



  "NM_181742" in other vectors (4)

Reward yourself with an Amazon® Card when get any 3 cDNA clones.

USD 420.00


Availability*
In Stock

Size
    • 10 ug


Product images

Specifications

Product Data
Product Name ORC4L (ORC4) (NM_181742) Human Tagged ORF Clone
Type Human Tagged ORF Clone
Tag Myc-DDK
Symbol ORC4
Synonyms ORC4L; ORC4P
Vector pCMV6-Entry
E. coli Selection Kanamycin (25 ug/mL)
Cell Selection Neomycin
Sequence Data
>RC211713 representing NM_181742
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGAGCAGTCGTAAATCAAAGAGTAACAGCTTAATTCACACAGAGTGCCTTTCACAGGTACAAAGAATTT
TACGTGAAAGATTTTGTCGTCAGAGTCCACATAGTAACCTATTTGGAGTGCAAGTACAATACAAACACTT
AAGTGAGCTGCTGAAAAGAACTGCTCTCCATGGAGAGAGTAACTCTGTCCTTATTATCGGACCCCGAGGA
TCAGGAAAAACTATGTTAATAAATCATGCTTTGAAAGAACTCATGGAAATAGAAGAAGTGAGTGAAAATG
TATTACAAGTTCACTTAAATGGACTGCTGCAGATCAATGACAAAATCGCCCTAAAGGAAATCACAAGGCA
GTTAAATCTGGAAAATGTAGTTGGAGATAAAGTTTTTGGAAGCTTTGCTGAAAACCTTTCATTTCTTCTG
GAAGCTTTAAAAAAAGGTGACCGAACTAGCAGTTGCCCAGTGATCTTCATATTAGATGAATTTGATCTTT
TTGCTCATCATAAAAACCAAACACTTCTCTATAATCTTTTTGACATTTCTCAGTCTGCACAGACCCCAAT
AGCAGTTATTGGTCTTACATGTAGATTGGATATTTTGGAACTCTTAGAAAAAAGAGTGAAGTCAAGATTT
TCTCACCGGCAGATACACTTAATGAATTCATTTGGTTTTCCACAGTATGTTAAAATATTTAAAGAACAGT
TATCTCTACCTGCAGAGTTTCCAGACAAGGTTTTTGCTGAGAAGTGGAATGAAAATGTTCAGTATCTCTC
AGAAGATAGAAGTGTGCAAGAAGTACTACAGAAGCATTTCAATATCAGCAAAAACCTGCGGTCATTACAC
ATGCTATTGATGCTTGCTTTAAATCGAGTAACAGCATCGCACCCATTTATGACTGCCGTAGATCTAATGG
AAGCAAGCCAACTGTGTAGCATGGACTCGAAAGCAAATATTGTACATGGTCTATCAGTCTTGGAAATCTG
TCTTATAATAGCAATGAAACATTTAAATGACATCTATGAGGAAGAGCCATTTAATTTTCAAATGGTCTAT
AATGAGTTTCAGAAGTTTGTTCAAAGGAAAGCACATTCCGTTTATAATTTTGAAAAACCTGTTGTCATGA
AGGCTTTTGAACACTTGCAGCAATTAGAATTAATAAAGCCCATGGAAAGAACTTCAGGAAATTCACAGAG
AGAGTACCAGCTGATGAAACTGCTTTTGGATAATACTCAAATTATGAATGCTCTGCAGAAATATCCCAAC
TGTCCTACAGATGTGAGGCAGTGGGCAACATCCTCACTAAGCTGGTTA


ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT
ACAAGGATGACGACGATAAG
GTTTAA
>RC211713 representing NM_181742
Red=Cloning site Green=Tags(s)

MSSRKSKSNSLIHTECLSQVQRILRERFCRQSPHSNLFGVQVQYKHLSELLKRTALHGESNSVLIIGPRG
SGKTMLINHALKELMEIEEVSENVLQVHLNGLLQINDKIALKEITRQLNLENVVGDKVFGSFAENLSFLL
EALKKGDRTSSCPVIFILDEFDLFAHHKNQTLLYNLFDISQSAQTPIAVIGLTCRLDILELLEKRVKSRF
SHRQIHLMNSFGFPQYVKIFKEQLSLPAEFPDKVFAEKWNENVQYLSEDRSVQEVLQKHFNISKNLRSLH
MLLMLALNRVTASHPFMTAVDLMEASQLCSMDSKANIVHGLSVLEICLIIAMKHLNDIYEEEPFNFQMVY
NEFQKFVQRKAHSVYNFEKPVVMKAFEHLQQLELIKPMERTSGNSQREYQLMKLLLDNTQIMNALQKYPN
CPTDVRQWATSSLSWL

myc-FLAG tag
Chromatograms CHROMATOGRAMS
Sequencher program is needed, download here.
Restriction Sites SgfI-MluI      Cloning Scheme for this gene      Plasmid Map     
ACCN NM_181742
ORF Size 1308 bp
OTI Disclaimer The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Product Components The ORF clone is ion-exchange column purified, transfection-ready dried plasmid DNA, and shipped with 2 vector sequencing primers.
Reconstitution 1. Centrifuge at 5,000xg for 5min.
2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA.
3. Close the tube and incubate for 10 minutes at room temperature.
4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom.
5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C.
Reference Data
RefSeq NM_181742.1, NM_181742.2, NM_181742.3, NP_859526.1
RefSeq Size 2795 bp
RefSeq ORF 1311 bp
Locus ID 5000
Cytogenetics 2q23.1
Protein Pathways Cell cycle
MW 50.2 kDa
Gene Summary The origin recognition complex (ORC) is a highly conserved six subunit protein complex essential for the initiation of the DNA replication in eukaryotic cells. Studies in yeast demonstrated that ORC binds specifically to origins of replication and serves as a platform for the assembly of additional initiation factors such as Cdc6 and Mcm proteins. This gene encodes a subunit of the ORC complex. Several alternatively spliced transcript variants, some of which encode the same protein, have been reported for this gene. [provided by RefSeq, Oct 2010]

Other Versions

Other products for "ORC4"
Frequently bought together (3)
Clone OTI4C5, Anti-DDK (FLAG) monoclonal antibody
    • 100 ul

USD 310.00


pCMV6-Entry, mammalian vector with C-terminal Myc- DDK Tag, 10ug
    • 10 ug

USD 570.00


Goat Polyclonal Antibody against ORC4L
    • 100 ug

USD 375.00

Customer Reviews 
Loading...
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.
68 Mouse Clones
Molbio tools