CELSR1 (NM_014246) Human Tagged ORF Clone

CAT#: RC211652

CELSR1 (Myc-DDK-tagged)-Human cadherin, EGF LAG seven-pass G-type receptor 1 (flamingo homolog, Drosophila) (CELSR1)

Clone Modification / Custom Cloning Service

  • TrueORF®

USD 1,999.00


Availability*
In Stock

Size
    • 10 ug

Product images

Specifications

Product Data
Product Name CELSR1 (NM_014246) Human Tagged ORF Clone
Symbol CELSR1
Synonyms ADGRC1; CDHF9; FMI2; HFMI2; ME2
Vector pCMV6-Entry
Sequence Data
ORF Nucleotide Sequence
>RC211652 representing NM_014246
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGGCGCCGCCGCCGCCGCCCGTGCTGCCCGTGCTGCTGCTCCTGGCCGCCGCCGCCGCCCTGCCGGCGA
TGGGGCTGCGAGCGGCCGCCTGGGAGCCGCGCGTACCCGGCGGGACCCGCGCCTTCGCCCTCCGGCCCGG
CTGTACCTACGCGGTGGGCGCCGCTTGCACGCCCCGGGCGCCGCGGGAGCTGCTGGACGTGGGCCGCGAT
GGGCGGCTGGCAGGACGTCGGCGCGTCTCGGGCGCGGGGCGCCCGCTGCCGCTGCAAGTCCGCTTGGTGG
CCCGCAGTGCCCCGACGGCGCTGAGCCGCCGCCTGCGGGCGCGCACGCACCTTCCCGGCTGCGGAGCCCG
TGCCCGGCTCTGCGGAACCGGTGCCCGGCTCTGCGGGGCGCTCTGCTTCCCCGTCCCCGGCGGCTGCGCG
GCCGCGCAGCATTCGGCGCTCGCAGCTCCGACCACCTTACCCGCCTGCCGCTGCCCGCCGCGCCCCAGGC
CCCGCTGTCCCGGCCGTCCCATCTGCCTGCCGCCGGGCGGCTCGG[AT]CCGCCTGCGTCTGCTGTGCGC
CCTGCGGCGCGCGGCTGGCGCCGTCCGGGTGGGACTGGCGCTGGAGGCCGCCACCGCGGGGACGCCCTCC
GCGTCGCCATCCCCATCGCCGCCCCTGCCGCCGAACTTGCCCGAAGCCCGGGCGGGGCCGGCGCGACGGG
CCCGGCGGGGCACGAGCGGCAGAGGGAGCCTGAAGTTTCCGATGCCCAACTACCAGGTGGCGTTGTTTGA
GAACGAACCGGCGGGCACCCTCATCCTCCAGCTGCACGCGCACTACACCATCGAGGGCGAGGAGGAGCGC
GTGAGCTATTACATGGAGGGGCTGTTCGACGAGCGCTCCCGGGGCTACTTCCGAATCGACTCTGCCACGG
GCGCCGTGAGCACGGACAGCGTACTGGACCGCGAGACCAAGGAGACGCACGTCCTCAGGGTGAAAGCCGT
GGACTACAGTACGCCGCCGCGCTCGGCCACCACCTACATCACTGTCTTGGTCAAAGACACCAACGACCAC
AGCCCGGTCTTCGAGCAGTCGGAGTACCGCGAGCGCGTGCGGGAGAACCTGGAGGTGGGCTACGAGGTGC
TGACCATCCGCGCCAGCGACCGCGACTCGCCCATCAACGCCAACTTGCGTTACCGCGTGTTGGGGGGCGC
GTGGGACGTCTTCCAGCTCAACGAGAGCTCTGGCGTGGTGAGCACACGGGCGGTGCTGGACCGGGAGGAG
GCGGCCGAGTACCAGCTCCTGGTGGAGGCCAACGACCAGGGGCGCAATCCGGGCCCGCTCAGTGCCACGG
CCACCGTGTACATCGAGGTGGAGGACGAGAACGACAACTACCCCCAGTTCAGCGAGCAGAACTACGTGGT
CCAGGTGCCCGAGGACGTGGGGCTCAACACGGCTGTGCTGCGAGTGCAGGCCACGG[AT]CCGGGACCAG
GGCCAGAACGCGGCCATTCACTACAGCATCCTCAGCGGGAACGTGGCCGGCCAGTTCTACCTGCACTCGC
TGAGCGGGATCCTGGATGTGATCAACCCCTTGGATTTCGAGGATGTCCAGAAATACTCGCTGAGCATTAA
GGCCCAGGATGGGGGCCGGCCCCCGCTCATCAATTCTTCAGGGGTGGTGTCTGTGCAGGTGCTGGATGTC
AACGACAACGAGCCTATCTTTGTGAGCAGCCCCTTCCAGGCCACGGTGCTGGAGAATGTGCCCCTGGGCT
ACCCCGTGGTGCACATTCAGGCGGTGGACGCGGACTCTGGAGAGAACGCCCGGCTGCACTATCGCCTGGT
GGACACGGCCTCCACCTTTCTGGGGGGCGGCAGCGCTGGGCCTAAGAATCCTGCCCCCACCCCTGACTTC
CCCTTCCAGATCCACAACAGCTCCGGTTGGATCACAGTGTGTGCCGAGCTGGACCGCGAGGAGGTGGAGC
ACTACAGCTTCGGGGTGGAGGCGGTGGACCACGGCTCGCCCCCCATGAGCTCCTCCACCAGCGTGTCCAT
CACGGTGCTGGACGTGAATGACAACGACCCGGTGTTCACGCAGCCCACCTACGAGCTTCGTCTGAATGAG
GATGCGGCCGTGGGGAGCAGCGTGCTGACCCTGCAGGCCCGCGACCGTGACGCCAACAGTGTGATTACCT
ACCAGCTCACAGGCGGCAACACCCGGAACCGCTTTGCACTCAGCAGCCAGAGAGGGGGCGGCCTCATCAC
CCTGGCGCTACCTCTGGACTACAAGCAGGAGCAGCAGTACGTGCTGGCGGTGACAGCATCCGACGGCACA
CGGTCGCACACTGCGCATGTCCTAATCAACGTCACTGATGCCAACACCCACAGGCCTGTCTTTCAGAGCT
CCCATTACACAGTGAGTGTCAGTGAGGACAGGCCTGTGGGCACCTCCATTGCTACCCTCAGTGCCAACGA
TGAGGACACAGGAGAGAATGCCCGCATCACCTACGTGATTCAGGACCCCGTGCCGCAGTTCCGCATTGAC
CCCGACAGTGGCACCATGTACACCATGATGGAGCTGGACTATGAGAACCAGGTCGCCTACACGCTGACCA
TCATGGCCCAGGACAACGGCATCCCGCAGAAATCAGACACCACCACCCTAGAGATCCTCATCCTCGATGC
CAATGACAATGCACCCCAGTTCCTGTGGGATTTCTACCAGGGTTCCATCTTTGAGGATGCTCCACCCTCG
ACCAGCATCCTCCAGGTCTCTGCCACGG[AT]CCGGGACTCAGGTCCCAATGGGCGTCTGCTGTACACCT
TCCAGGGTGGGGACGACGGCGATGGGGACTTCTACATCGAGCCCACGTCCGGTGTGATTCGCACCCAGCG
CCGGCTGGACCGGGAGAATGTGGCCGTGTACAACCTTTGGGCTCTGGCTGTGGATCGGGGCAGTCCCACT
CCCCTTAGCGCCTCGGTAGAAATCCAGGTGACCATCTTGGACATTAATGACAATGCCCCCATGTTTGAGA
AGGACGAACTGGAGCTGTTTGTTGAGGAGAACAACCCAGTGGGGTCGGTGGTGGCAAAGATTCGTGCTAA
CGACCCTGATGAAGGCCCTAATGCCCAGATCATGTATCAGATTGTGGAAGGGGACATGCGGCATTTCTTC
CAGCTGGACCTGCTCAACGGGGACCTGCGTGCCATGGTGGAGCTGGACTTTGAGGTCCGGCGGGAGTATG
TGCTGGTGGTGCAGGCCACGTCGGCTCCGCTGGTGAGCCGAGCCACGGTGCACATCCTTCTCGTGGACCA
GAATGACAACCCGCCTGTGCTGCCCGACTTCCAGATCCTCTTCAACAACTATGTCACCAACAAGTCCAAC
AGTTTCCCCACCGGCGTGATCGGCTGCATCCCGGCCCATGACCCCGACGTGTCAGACAGCCTCAACTACA
CCTTCGTGCAGGGCAACGAGCTGCGCCTGTTGCTGCTGGACCCCGCCACGGGCGAACTGCAGCTCAGCCG
CGACCTGGACAACAACCGGCCGCTGGAGGCGCTCATGGAGGTGTCTGTGTCTGATGGCATCCACAGCGTC
ACGGCCTTCTGCACCCTGCGTGTCACCATCATCACGGACGACATGCTGACCAACAGCATCACTGTCCGCC
TGGAGAACATGTCCCAGGAGAAGTTCCTGTCCCCGCTGCTGGCCCTCTTCGTGGAGGGGGTGGCCGCCGT
GCTGTCCACCACCAAGGACGACGTCTTCGTCTTCAACGTCCAGAACGACACCGACGTCAGCTCCAACATC
CTGAACGTGACCTTCTCGGCGCTGCTGCCTGGCGGCGTCCGCGGCCAGTTCTTCCCGTCGGAGGACCTGC
AGGAGCAGATCTACCTGAATCGGACGCTGCTGACCACCATCTCCACGCAGCGCGTGCTGCCCTTCGACGA
CAACATCTGCCTGCGCGAGCCCTGCGAGAACTACATGAAGTGCGTGTCCGTTCTGCGATTCGACAGCTCC
GCGCCCTTCCTCAGCTCCACCACCGTGCTCTTCCGGCCCATCCACCCCATCAACGGCCTGCGCTGCCGCT
GCCCGCCCGGCTTCACCGGCGACTACTGCGAGACGGAGATCGACCTCTGCTACTCCGACCCGTGCGGCGC
CAACGGCCGCTGCCGCAGCCGCGAGGGCGGCTACACCTGCGAGTGCTTCGAGGACTTCACTGGAGAGCAC
TGTGAGGTGGATGCCCGCTCAGGCCGCTGTGCCAACGGGGTGTGCAAGAACGGGGGCACCTGCGTGAACC
TGCTCATCGGCGGCTTCCACTGCGTGTGTCCTCCTGGCGAGTATGAGAGGCCCTACTGTGAGGTGACCAC
CAGGAGCTTCCCGCCCCAGTCCTTCGTCACCTTCCGGGGCCTGAGACAGCGCTTCCACTTCACCATCTCC
CTCACGTTTGCCACTCAGGAAAGGAACGGCTTGCTTCTCTACAACGGCCGCTTCAATGAGAAGCACGACT
TCATCGCCCTGGAGATCGTGGACGAGCAGGTGCAGCTCACCTTCTCTGCAGGCGAGACAACAACGACCGT
GGCACCGAAGGTTCCCAGTGGTGTGAGTGACGGGCGGTGGCACTCTGTGCAGGTGCAGTACTACAACAAG
CCCAATATTGGCCACCTGGGCCTGCCCCATGGGCCGTCCGGGGAAAAGATGGCCGTGGTGACAGTGGATG
ATTGTGACACAACCATGGCTGTGCGCTTTGGAAAGGACATCGGGAACTACAGCTGCGCTGCCCAGGGCAC
TCAGACCGGCTCCAAGAAGTCCCTGGATCTGACCGGCCCTCTACTCCTGGGGGGTGTCCCCAACCTGCCA
GAAGACTTCCCAGTGCACAACCGGCAGTTCGTGGGCTGCATGCGGAACCTGTCAGTCGACGGCAAAAATG
TGGACATGGCCGGATTCATCGCCAACAATGGCACCCGGGAAGGCTGCGCTGCTCGGAGGAACTTCTGCGA
TGGGAGGCGGTGTCAGAATGGAGGCACCTGTGTCAACAGGTGGAATATGTATCTGTGTGAGTGTCCACTC
CGATTCGGCGGGAAGAACTGTGAGCAAGCCATGCCTCACCCCCAGCTCTTCAGCGGTGAGAGCGTCGTGT
CCTGGAGTGACCTGAACATCATCATCTCTGTGCCCTGGTACCTGGGGCTCATGTTCCGGACCCGGAAGGA
GGACAGCGTTCTGATGGAGGCCACCAGTGGTGGGCCCACCAGCTTTCGCCTCCAGATCCTGAACAACTAC
CTCCAGTTTGAGGTGTCCCACGGCCCCTCCGATGTGGAGTCCGTGATGCTGTCCGGGTTGCGGGTGACCG
ACGGGGAGTGGCACCACCTGCTGATCGAGCTGAAGAATGTTAAGGAGGACAGTGAGATGAAGCACCTGGT
CACCATGACCTTGGACTATGGGATGGACCAGAACAAGGCAGATATCGGGGGCATGCTTCCCGGGCTGACG
GTAAGGAGCGTGGTGGTCGGAGGCGCCTCTGAAGACAAGGTCTCCGTGCGCCGTGGATTCCGAGGCTGCA
TGCAGGGAGTGAGGATGGGGGGGACGCCCACCAACGTCGCCACCCTGAACATGAACAACGCACTCAAGGT
CAGGGTGAAGGACGGCTGTGATGTGGACGACCCCTGTACCTCGAGCCCCTGTCCCCCCAATAGCCGCTGC
CACGACGCCTGGGAGGACTACAGCTGCGTCTGTGACAAAGGGTACCTTGGAATAAACTGTGTGGATGCCT
GTCACCTGAACCCCTGCGAGAACATGGGGGCCTGCGTGCGCTCCCCCGGCTCCCCGCAGGGCTACGTGTG
CGAGTGTGGGCCCAGTCACTACGGGCCGTACTGTGAGAACAAACTCGACCTTCCGTGCCCCAGAGGCTGG
TGGGGGAACCCCGTCTGTGGACCCTGCCACTGTGCCGTCAGCAAAGGCTTTGATCCCGACTGTAATAAGA
CCAACGGCCAGTGCCAATGCAAGGAGAATTACTACAAGCTCCTAGCCCAGGACACCTGTCTGCCCTGCGA
CTGCTTCCCCCATGGCTCCCACAGCCGCACTTGCGACATGGCCACCGGGCAGTGTGCCTGCAAGCCCGGC
GTCATCGGCCGCCAGTGCAACCGCTGCGACAACCCGTTTGCCGAGGTCACCACGCTCGGCTGTGAAGTGA
TCTACAATGGCTGTCCCAAAGCATTTGAGGCCGGCATCTGGTGGCCACAGACCAAGTTCGGGCAGCCGGC
TGCGGTGCCATGCCCTAAGGGATCCGTTGGAAATGCGG[AT]CCGACACTGCAGCGGGGAGAAGGGCTGG
CTGCCCCCAGAGCTCTTTAACTGTACCACCATCTCCTTCGTGGACCTCAGGGCCATGAATGAGAAGCTGA
GCCGCAATGAGACGCAGGTGGACGGCGCCAGGGCCCTGCAGCTGGTGAGGGCGCTGCGCAGTGCTACACA
GCACACGGGCACGCTCTTTGGCAATGACGTGCGCACGGCCTACCAGCTGCTGGGCCACGTCCTTCAGCAC
GAGAGCTGGCAGCAGGGCTTCGACCTGGCAGCCACGCAGGACGCCGACTTTCACGAGGACGTCATCCACT
CGGGCAGCGCCCTCCTGGCCCCAGCCACCAGGGCGGCGTGGGAGCAGATCCAGCGGAGCGAGGGCGGCAC
GGCACAGCTGCTCCGGCGCCTCGAGGGCTACTTCAGCAACGTGGCACGCAACGTGCGGCGGACGTACCTG
CGGCCCTTCGTCATCGTCACCGCCAACATGATTCTTGCTGTCGACATCTTTGACAAGTTCAACTTTACGG
GAGCCAGGGTCCCGCGATTCGACACCATCCATGAAGAGTTCCCCAGGGAGCTGGAGTCCTCCGTCTCCTT
CCCAGCCGACTTCTTCAGACCACCTGAAGAAAAAGAAGGCCCCCTGCTGAGGCCGGCTGGCCGGAGGACC
ACCCCGCAGACCACGCGCCCGGGGCCTGGCACCGAGAGGGAGGCCCCGATCAGCAGGCGGAGGCGACACC
CTGATGACGCTGGCCAGTTCGCCGTCGCTCTGGTCATCATTTACCGCACCCTGGGGCAGCTCCTGCCCGA
GCGCTACGACCCCGACCGTCGCAGCCTCCGGTTGCCTCACCGGCCCATCATTAATACCCCGATGGTGAGC
ACGCTGGTGTACAGCGAGGGGGCTCCGCTCCCGAGACCCCTGGAGAGGCCCGTCCTGGTGGAGTTCGCCC
TGCTGGAGGTGGAGGAGCGAACCAAGCCTGTCTGCGTGTTCTGGAACCACTCCCTGGCCGTTGGTGGGAC
GGGAGGGTGGTCTGCCCGGGGCTGCGAGCTCCTGTCCAGGAACCGGACACATGTCGCCTGCCAGTGCAGC
CACACAGCCAGCTTTGCGGTGCTCATGGATATCTCCAGGCGTGAGAACGGGGAGGTCCTGCCTCTGAAGA
TTGTCACCTATGCCGCTGTGTCCTTGTCACTGGCAGCCCTGCTGGTGGCCTTCGTCCTCCTGAGCCTGGT
CCGCATGCTGCGCTCCAACCTGCACAGCATTCACAAGCACCTCGCCGTGGCGCTCTTCCTCTCTCAGCTG
GTGTTCGTGATTGGGATCAACCAGACGGAAAACCCGTTTCTGTGCACAGTGGTTGCCATCCTCCTCCACT
ACATCTACATGAGCACCTTTGCCTGGACCCTCGTGGAGAGCCTGCATGTCTACCGCATGCTGACCGAGGT
GCGCAACATCGACACGGGGCCCATGCGGTTCTACTACGTCGTGGGCTGGGGCATCCCGGCCATTGTCACA
GGACTGGCGGTCGGCCTGGACCCCCAGGGCTACGGGAACCCCGACTTCTGCTGGCTGTCGCTTCAAGACA
CCCTGATTTGGAGCTTTGCGGGGCCCATCGGAGCTGTTATAATCATCAACACAGTCACTTCTGTCCTATC
TGCAAAGGTTTCCTGCCAAAGAAAGCACCATTATTATGGGAAAAAAGGGATCGTCTCCCTGCTGAGGACC
GCATTCCTCCTGCTGCTGCTCATCAGCGCCACCTGGCTGCTGGGGCTGCTGGCTGTGAACCGCGATGCAC
TGAGCTTTCACTACCTCTTCGCCATCTTCAGCGGCTTACAGGGCCCCTTCGTCCTCCTTTTCCACTGCGT
GCTCAACCAGGAGGTCCGGAAGCACCTGAAGGGCGTGCTCGGCGGGAGGAAGCTGCACCTGGAGGACTCC
GCCACCACCAGGGCCACCCTGCTGACGCGCTCCCTCAACTGCAACACCACCTTCGGTGACGGGCCTGACA
TGCTGCGCACAGACTTGGGCGAGTCCACCGCCTCGCTGGACAGCATCGTCAGGGATGAAGGGATCCAGAA
GCTCGGCGTGTCCTCTGGGCTGGTGAGGGGCAGCCACGGAGAGCCAGACGCGTCCCTCATGCCCAGGAGC
TGCAAGGATCCCCCTGGCCACGATTCCGACTCAGATAGCGAGCTGTCCCTGGATGAGCAGAGCAGCTCTT
ACGCCTCCTCACACTCGTCAGACAGCGAGGACGATGGGGTGGGAGCTGAGGAAAAATGGGACCCGGCCAG
GGGCGCCGTCCACAGCACCCCCAAAGGGGACGCTGTGGCCAACCACGTTCCGGCCGGCTGGCCCGACCAG
AGCCTGGCTGAGAGTGACAGTGAGGACCCCAGCGGCAAGCCCCGCCTGAAGGTGGAGACCAAGGTCAGCG
TGGAGCTGCACCGCGAGGAGCAGGGCAGTCACCGTGGAGAGTACCCCCCGGACCAGGAGAGCGGGGGCGC
AGCCAGGCTTGCTAGCAGCCAGCCCCCAGAGCAGAGGAAAGGCATCTTGAAAAATAAAGTCACCTACCCG
CCGCCGCTGACGCTGACGGAGCAGACGCTGAAGGGCCGGCTCCGGGAGAAGCTGGCCGACTGTGAGCAGA
GCCCCACATCCTCGCGCACGTCTTCCCTGGGCTCTGGCGGCCCCGACTGCGCCATCACAGTCAAGAGCCC
TGGGAGGGAGCCGGGGCGTGACCACCTCAACGGGGTGGCCATGAATGTGCGCACTGGGAGCGCCCAGGCC
GATGGCTCCGACTCTGAGAAACCG


CAAGCTTAACTAGCTAGCGGACCGACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATC
TGGCAGCAAATGATATCCTGGATTACAAGGATGACGACGATAAGG
TTTAAAC
Protein Sequence
>RC211652 representing NM_014246
Red=Cloning site Green=Tags(s)

MAPPPPPVLPVLLLLAAAAALPAMGLRAAAWEPRVPGGTRAFALRPGCTYAVGAACTPRAPRELLDVGRD
GRLAGRRRVSGAGRPLPLQVRLVARSAPTALSRRLRARTHLPGCGARARLCGTGARLCGALCFPVPGGCA
AAQHSALAAPTTLPACRCPPRPRPRCPGRPICLPPGGSXXRLRLLCALRRAAGAVRVGLALEAATAGTPS
ASPSPSPPLPPNLPEARAGPARRARRGTSGRGSLKFPMPNYQVALFENEPAGTLILQLHAHYTIEGEEER
VSYYMEGLFDERSRGYFRIDSATGAVSTDSVLDRETKETHVLRVKAVDYSTPPRSATTYITVLVKDTNDH
SPVFEQSEYRERVRENLEVGYEVLTIRASDRDSPINANLRYRVLGGAWDVFQLNESSGVVSTRAVLDREE
AAEYQLLVEANDQGRNPGPLSATATVYIEVEDENDNYPQFSEQNYVVQVPEDVGLNTAVLRVQATXXRDQ
GQNAAIHYSILSGNVAGQFYLHSLSGILDVINPLDFEDVQKYSLSIKAQDGGRPPLINSSGVVSVQVLDV
NDNEPIFVSSPFQATVLENVPLGYPVVHIQAVDADSGENARLHYRLVDTASTFLGGGSAGPKNPAPTPDF
PFQIHNSSGWITVCAELDREEVEHYSFGVEAVDHGSPPMSSSTSVSITVLDVNDNDPVFTQPTYELRLNE
DAAVGSSVLTLQARDRDANSVITYQLTGGNTRNRFALSSQRGGGLITLALPLDYKQEQQYVLAVTASDGT
RSHTAHVLINVTDANTHRPVFQSSHYTVSVSEDRPVGTSIATLSANDEDTGENARITYVIQDPVPQFRID
PDSGTMYTMMELDYENQVAYTLTIMAQDNGIPQKSDTTTLEILILDANDNAPQFLWDFYQGSIFEDAPPS
TSILQVSATXXRDSGPNGRLLYTFQGGDDGDGDFYIEPTSGVIRTQRRLDRENVAVYNLWALAVDRGSPT
PLSASVEIQVTILDINDNAPMFEKDELELFVEENNPVGSVVAKIRANDPDEGPNAQIMYQIVEGDMRHFF
QLDLLNGDLRAMVELDFEVRREYVLVVQATSAPLVSRATVHILLVDQNDNPPVLPDFQILFNNYVTNKSN
SFPTGVIGCIPAHDPDVSDSLNYTFVQGNELRLLLLDPATGELQLSRDLDNNRPLEALMEVSVSDGIHSV
TAFCTLRVTIITDDMLTNSITVRLENMSQEKFLSPLLALFVEGVAAVLSTTKDDVFVFNVQNDTDVSSNI
LNVTFSALLPGGVRGQFFPSEDLQEQIYLNRTLLTTISTQRVLPFDDNICLREPCENYMKCVSVLRFDSS
APFLSSTTVLFRPIHPINGLRCRCPPGFTGDYCETEIDLCYSDPCGANGRCRSREGGYTCECFEDFTGEH
CEVDARSGRCANGVCKNGGTCVNLLIGGFHCVCPPGEYERPYCEVTTRSFPPQSFVTFRGLRQRFHFTIS
LTFATQERNGLLLYNGRFNEKHDFIALEIVDEQVQLTFSAGETTTTVAPKVPSGVSDGRWHSVQVQYYNK
PNIGHLGLPHGPSGEKMAVVTVDDCDTTMAVRFGKDIGNYSCAAQGTQTGSKKSLDLTGPLLLGGVPNLP
EDFPVHNRQFVGCMRNLSVDGKNVDMAGFIANNGTREGCAARRNFCDGRRCQNGGTCVNRWNMYLCECPL
RFGGKNCEQAMPHPQLFSGESVVSWSDLNIIISVPWYLGLMFRTRKEDSVLMEATSGGPTSFRLQILNNY
LQFEVSHGPSDVESVMLSGLRVTDGEWHHLLIELKNVKEDSEMKHLVTMTLDYGMDQNKADIGGMLPGLT
VRSVVVGGASEDKVSVRRGFRGCMQGVRMGGTPTNVATLNMNNALKVRVKDGCDVDDPCTSSPCPPNSRC
HDAWEDYSCVCDKGYLGINCVDACHLNPCENMGACVRSPGSPQGYVCECGPSHYGPYCENKLDLPCPRGW
WGNPVCGPCHCAVSKGFDPDCNKTNGQCQCKENYYKLLAQDTCLPCDCFPHGSHSRTCDMATGQCACKPG
VIGRQCNRCDNPFAEVTTLGCEVIYNGCPKAFEAGIWWPQTKFGQPAAVPCPKGSVGNAXXRHCSGEKGW
LPPELFNCTTISFVDLRAMNEKLSRNETQVDGARALQLVRALRSATQHTGTLFGNDVRTAYQLLGHVLQH
ESWQQGFDLAATQDADFHEDVIHSGSALLAPATRAAWEQIQRSEGGTAQLLRRLEGYFSNVARNVRRTYL
RPFVIVTANMILAVDIFDKFNFTGARVPRFDTIHEEFPRELESSVSFPADFFRPPEEKEGPLLRPAGRRT
TPQTTRPGPGTEREAPISRRRRHPDDAGQFAVALVIIYRTLGQLLPERYDPDRRSLRLPHRPIINTPMVS
TLVYSEGAPLPRPLERPVLVEFALLEVEERTKPVCVFWNHSLAVGGTGGWSARGCELLSRNRTHVACQCS
HTASFAVLMDISRRENGEVLPLKIVTYAAVSLSLAALLVAFVLLSLVRMLRSNLHSIHKHLAVALFLSQL
VFVIGINQTENPFLCTVVAILLHYIYMSTFAWTLVESLHVYRMLTEVRNIDTGPMRFYYVVGWGIPAIVT
GLAVGLDPQGYGNPDFCWLSLQDTLIWSFAGPIGAVIIINTVTSVLSAKVSCQRKHHYYGKKGIVSLLRT
AFLLLLLISATWLLGLLAVNRDALSFHYLFAIFSGLQGPFVLLFHCVLNQEVRKHLKGVLGGRKLHLEDS
ATTRATLLTRSLNCNTTFGDGPDMLRTDLGESTASLDSIVRDEGIQKLGVSSGLVRGSHGEPDASLMPRS
CKDPPGHDSDSDSELSLDEQSSSYASSHSSDSEDDGVGAEEKWDPARGAVHSTPKGDAVANHVPAGWPDQ
SLAESDSEDPSGKPRLKVETKVSVELHREEQGSHRGEYPPDQESGGAARLASSQPPEQRKGILKNKVTYP
PPLTLTEQTLKGRLREKLADCEQSPTSSRTSSLGSGGPDCAITVKSPGREPGRDHLNGVAMNVRTGSAQA
DGSDSEKP

NNNNEQKLISEEDLAANDILDYKDDDDKV
Chromatograms CHROMATOGRAMS
Sequencher program is needed, download here.
Restriction Sites SgfI-HindIII      Cloning Scheme for this gene     
Tag Myc-DDK
ACCN NM_014246
ORF Size 9054 bp
OTI Disclaimer The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Product Components The ORF clone is ion-exchange column purified, transfection-ready dried plasmid DNA, and shipped with 2 vector sequencing primers.
Reference Data
RefSeq NM_014246.1, NP_055061
RefSeq Size 11389
RefSeq ORF 9045
Locus ID 9620
Cytogenetics 22q13.31
Protein Families Transmembrane, Druggable Genome
MW 326.97 kDa
Gene Summary Receptor that may have an important role in cell/cell signaling during nervous system formation. [UniProtKB/Swiss-Prot Function]
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Citations