BCL2L10 (NM_020396) Human Tagged ORF Clone

CAT#: RC211604

BCL2L10 (Myc-DDK-tagged)-Human BCL2-like 10 (apoptosis facilitator) (BCL2L10)

Change vector?

  • TrueORF®

USD 98

USD 390


Availability*
In Stock

Size
    • 10 ug

Product images

Specifications

Product Data
Product Name BCL2L10 (NM_020396) Human Tagged ORF Clone
Symbol BCL2L10
Synonyms BCL-B; Boo; Diva
Vector pCMV6-Entry
Sequence Data
ORF Nucleotide Sequence
>RC211604 representing NM_020396
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGGTTGACCAGTTGCGGGAGCGCACCACCATGGCCGACCCGCTGCGGGAGCGCACCGAGCTGTTGCTGG
CCGACTACCTGGGGTACTGCGCCCGGGAACCCGGCACCCCCGAGCCGGCGCCATCCACGCCCGAGGCCGC
CGTGCTGCGCTCCGCGGCCGCCAGGTTACGGCAGATTCACCGGTCCTTTTTCTCCGCCTACCTCGGCTAC
CCCGGGAACCGCTTCGAGCTGGTGGCGCTGATGGCGGATTCCGTGCTCTCCGACAGCCCCGGCCCCACCT
GGGGCAGAGTGGTGACGCTCGTGACCTTCGCAGGGACGCTGCTGGAGAGAGGGCCGCTGGTGACCGCCCG
GTGGAAGAAGTGGGGCTTCCAGCCGCGGCTAAAGGAGCAGGAGGGCGACGTCGCCCGGGACTGCCAGCGC
CTGGTGGCCTTGCTGAGCTCGCGGCTCATGGGGCAGCACCGCGCCTGGCTGCAGGCTCAGGGCGGCTGGG
ATGGCTTTTGTCACTTCTTCAGGACCCCCTTTCCACTGGCTTTTTGGAGAAAACAGCTGGTCCAGGCTTT
TCTGTCATGCTTGTTAACAACAGCCTTCATTTATCTCTGGACACGATTATTA


ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT
ACAAGGATGACGACGATAAG
GTTTAA
Protein Sequence
>RC211604 representing NM_020396
Red=Cloning site Green=Tags(s)

MVDQLRERTTMADPLRERTELLLADYLGYCAREPGTPEPAPSTPEAAVLRSAAARLRQIHRSFFSAYLGY
PGNRFELVALMADSVLSDSPGPTWGRVVTLVTFAGTLLERGPLVTARWKKWGFQPRLKEQEGDVARDCQR
LVALLSSRLMGQHRAWLQAQGGWDGFCHFFRTPFPLAFWRKQLVQAFLSCLLTTAFIYLWTRLL

myc-FLAG tag
Chromatograms CHROMATOGRAMS
Sequencher program is needed, download here.
Restriction Sites SgfI-MluI      Cloning Scheme for this gene      Plasmid Map     
Tag Myc-DDK
ACCN NM_020396
ORF Size 612 bp
OTI Disclaimer The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Product Components The ORF clone is ion-exchange column purified, transfection-ready dried plasmid DNA, and shipped with 2 vector sequencing primers.
Reference Data
RefSeq NM_020396.1, NM_020396.2, NM_020396.3, NP_065129
RefSeq Size 887
RefSeq ORF 615
Locus ID 10017
Cytogenetics 15q21.2
Protein Families Transmembrane, Druggable Genome
MW 23 kDa
Gene Summary The protein encoded by this gene belongs to the BCL-2 protein family. BCL-2 family members form hetero- or homodimers and act as anti- or pro-apoptotic regulators that are involved in a wide variety of cellular activities. The protein encoded by this gene contains conserved BH4, BH1 and BH2 domains. This protein can interact with other members of BCL-2 protein family including BCL2, BCL2L1/BCL-X(L), and BAX. Overexpression of this gene has been shown to suppress cell apoptosis possibly through the prevention of cytochrome C release from the mitochondria, and thus activating caspase-3 activation. The mouse counterpart of this protein is found to interact with Apaf1 and forms a protein complex with Caspase 9, which suggests the involvement of this protein in APAF1 and CASPASE 9 related apoptotic pathway. [provided by RefSeq, Jul 2008]
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Citations