L1CAM (NM_000425) Human Tagged ORF Clone

CAT#: RC211601

Reviews ()
Write a review

L1CAM (Myc-DDK-tagged)-Human L1 cell adhesion molecule (L1CAM), transcript variant 1



Reconstitution Protocol

Special Offer: 20% off the control vector (empty cloning vector without insert). Use code "Shuttle20".

USD 680.00


Availability*
In Stock

Size
    • 10 ug


Product images

Specifications

Product Data
Type Human Tagged ORF Clone
Tag Myc-DDK
Symbol L1CAM
Synonyms CAML1; CD171; HSAS; HSAS1; MASA; MIC5; N-CAM-L1; N-CAML1; NCAM-L1; S10; SPG1
Vector pCMV6-Entry
E. coli Selection Kanamycin (25 ug/mL)
Mammalian Cell Selection Neomycin
Sequence Data
>RC211601 representing NM_000425
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGGTCGTGGCGCTGCGGTACGTGTGGCCTCTCCTCCTCTGCAGCCCCTGCCTGCTTATCCAGATCCCCG
AGGAATATGAAGGACACCATGTGATGGAGCCACCTGTCATCACGGAACAGTCTCCACGGCGCCTGGTTGT
CTTCCCCACAGATGACATCAGCCTCAAGTGTGAGGCCAGTGGCAAGCCCGAAGTGCAGTTCCGCTGGACG
AGGGATGGTGTCCACTTCAAACCCAAGGAAGAGCTGGGTGTGACCGTGTACCAGTCGCCCCACTCTGGCT
CCTTCACCATCACGGGCAACAACAGCAACTTTGCTCAGAGGTTCCAGGGCATCTACCGCTGCTTTGCCAG
CAATAAGCTGGGCACCGCCATGTCCCATGAGATCCGGCTCATGGCCGAGGGTGCCCCCAAGTGGCCAAAG
GAGACAGTGAAGCCCGTGGAGGTGGAGGAAGGGGAGTCAGTGGTTCTGCCTTGCAACCCTCCCCCAAGTG
CAGAGCCTCTCCGGATCTACTGGATGAACAGCAAGATCTTGCACATCAAGCAGGACGAGCGGGTGACGAT
GGGCCAGAACGGCAACCTCTACTTTGCCAATGTGCTCACCTCCGACAACCACTCAGACTACATCTGCCAC
GCCCACTTCCCAGGCACCAGGACCATCATTCAGAAGGAACCCATTGACCTCCGGGTCAAGGCCACCAACA
GCATGATTGACAGGAAGCCGCGCCTGCTCTTCCCCACCAACTCCAGCAGCCACCTGGTGGCCTTGCAGGG
GCAGCCATTGGTCCTGGAGTGCATCGCCGAGGGCTTTCCCACGCCCACCATCAAATGGCTGCGCCCCAGT
GGCCCCATGCCAGCCGACCGTGTCACCTACCAGAACCACAACAAGACCCTGCAGCTGCTGAAAGTGGGCG
AGGAGGATGATGGCGAGTACCGCTGCCTGGCCGAGAACTCACTGGGCAGTGCCCGGCATGCGTACTATGT
CACCGTGGAGGCTGCCCCGTACTGGCTGCACAAGCCCCAGAGCCATCTATATGGGCCAGGAGAGACTGCC
CGCCTGGACTGCCAAGTCCAGGGCAGGCCCCAACCAGAGGTCACCTGGAGAATCAACGGGATCCCTGTGG
AGGAGCTGGCCAAAGACCAGAAGTACCGGATTCAGCGTGGCGCCCTGATCCTGAGCAACGTGCAGCCCAG
TGACACAATGGTGACCCAATGTGAGGCCCGCAACCGGCACGGGCTCTTGCTGGCCAATGCCTACATCTAC
GTTGTCCAGCTGCCAGCCAAGATCCTGACTGCGGACAATCAGACGTACATGGCTGTCCAGGGCAGCACTG
CCTACCTTCTGTGCAAGGCCTTCGGAGCGCCTGTGCCCAGTGTTCAGTGGCTGGACGAGGATGGGACAAC
AGTGCTTCAGGACGAACGCTTCTTCCCCTATGCCAATGGGACCCTGGGCATTCGAGACCTCCAGGCCAAT
GACACCGGACGCTACTTCTGCCTGGCTGCCAATGACCAAAACAATGTTACCATCATGGCTAACCTGAAGG
TTAAAGATGCAACTCAGATCACTCAGGGGCCCCGCAGCACAATCGAGAAGAAAGGTTCCAGGGTGACCTT
CACGTGCCAGGCCTCCTTTGACCCCTCCTTGCAGCCCAGCATCACCTGGCGTGGGGACGGTCGAGACCTC
CAGGAGCTTGGGGACAGTGACAAGTACTTCATAGAGGATGGGCGCCTGGTCATCCACAGCCTGGACTACA
GCGACCAGGGCAACTACAGCTGCGTGGCCAGTACCGAACTGGATGTGGTGGAGAGTAGGGCACAGCTCTT
GGTGGTGGGGAGCCCTGGGCCGGTGCCACGGCTGGTGCTGTCCGACCTGCACCTGCTGACGCAGAGCCAG
GTGCGCGTGTCCTGGAGTCCTGCAGAAGACCACAATGCCCCCATTGAGAAATATGACATTGAATTTGAGG
ACAAGGAAATGGCGCCTGAAAAATGGTACAGTCTGGGCAAGGTTCCAGGGAACCAGACCTCTACCACCCT
CAAGCTGTCGCCCTATGTCCACTACACCTTTAGGGTTACTGCCATAAACAAATATGGCCCCGGGGAGCCC
AGCCCGGTCTCTGAGACTGTGGTCACACCTGAGGCAGCCCCAGAGAAGAACCCTGTGGATGTGAAGGGGG
AAGGAAATGAGACCACCAATATGGTCATCACGTGGAAGCCGCTCCGGTGGATGGACTGGAACGCCCCCCA
GGTTCAGTACCGCGTGCAGTGGCGCCCTCAGGGGACACGAGGGCCCTGGCAGGAGCAGATTGTCAGCGAC
CCCTTCCTGGTGGTGTCCAACACGTCCACCTTCGTGCCCTATGAGATCAAAGTCCAGGCCGTCAACAGCC
AGGGCAAGGGACCAGAGCCCCAGGTCACTATCGGCTACTCTGGAGAGGACTACCCCCAGGCAATCCCTGA
GCTGGAAGGCATTGAAATCCTCAACTCAAGTGCCGTGCTGGTCAAGTGGCGGCCGGTGGACCTGGCCCAG
GTCAAGGGCCACCTCCGCGGATACAATGTGACGTACTGGAGGGAGGGCAGTCAGAGGAAGCACAGCAAGA
GACATATCCACAAAGACCATGTGGTGGTGCCCGCCAACACCACCAGTGTCATCCTCAGTGGCTTGCGGCC
CTATAGCTCCTACCACCTGGAGGTGCAGGCCTTTAACGGGCGAGGATCGGGGCCCGCCAGCGAGTTCACC
TTCAGCACCCCAGAGGGAGTGCCTGGCCACCCCGAGGCGTTGCACCTGGAGTGCCAGTCGAACACCAGCC
TGCTGCTGCGCTGGCAGCCCCCACTCAGCCACAACGGCGTGCTCACCGGCTACGTGCTCTCCTACCACCC
CCTGGATGAGGGGGGCAAGGGGCAACTGTCCTTCAACCTTCGGGACCCCGAACTTCGGACACACAACCTG
ACCGATCTCAGCCCCCACCTGCGGTACCGCTTCCAGCTTCAGGCCACCACCAAAGAGGGCCCTGGTGAAG
CCATCGTACGGGAAGGAGGCACTATGGCCTTGTCTGGGATCTCAGATTTTGGCAACATCTCAGCCACAGC
GGGTGAAAACTACAGTGTCGTCTCCTGGGTCCCCAAGGAGGGCCAGTGCAACTTCAGGTTCCATATCTTG
TTCAAAGCCTTGGGAGAAGAGAAGGGTGGGGCTTCCCTTTCGCCACAGTATGTCAGCTACAACCAGAGCT
CCTACACGCAGTGGGACCTGCAGCCTGACACTGACTACGAGATCCACTTGTTTAAGGAGAGGATGTTCCG
GCACCAAATGGCTGTGAAGACCAATGGCACAGGCCGCGTGAGGCTCCCTCCTGCTGGCTTCGCCACTGAG
GGCTGGTTCATCGGCTTTGTGAGTGCCATCATCCTCCTGCTCCTCGTCCTGCTCATCCTCTGCTTCATCA
AGCGCAGCAAGGGCGGCAAATACTCAGTGAAGGATAAGGAGGACACCCAGGTGGACTCTGAGGCCCGACC
GATGAAAGATGAGACCTTCGGCGAGTACAGGTCCCTGGAGAGTGACAACGAGGAGAAGGCCTTTGGCAGC
AGCCAGCCATCGCTCAACGGGGACATCAAGCCCCTGGGCAGTGACGACAGCCTGGCCGATTATGGGGGCA
GCGTGGATGTTCAGTTCAACGAGGATGGTTCGTTCATTGGCCAGTACAGTGGCAAGAAGGAGAAGGAGGC
GGCAGGGGGCAATGACAGCTCAGGGGCCACTTCCCCCATCAACCCTGCCGTGGCCCTAGAA


ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT
ACAAGGATGACGACGATAAG
GTTTAA
>RC211601 representing NM_000425
Red=Cloning site Green=Tags(s)

MVVALRYVWPLLLCSPCLLIQIPEEYEGHHVMEPPVITEQSPRRLVVFPTDDISLKCEASGKPEVQFRWT
RDGVHFKPKEELGVTVYQSPHSGSFTITGNNSNFAQRFQGIYRCFASNKLGTAMSHEIRLMAEGAPKWPK
ETVKPVEVEEGESVVLPCNPPPSAEPLRIYWMNSKILHIKQDERVTMGQNGNLYFANVLTSDNHSDYICH
AHFPGTRTIIQKEPIDLRVKATNSMIDRKPRLLFPTNSSSHLVALQGQPLVLECIAEGFPTPTIKWLRPS
GPMPADRVTYQNHNKTLQLLKVGEEDDGEYRCLAENSLGSARHAYYVTVEAAPYWLHKPQSHLYGPGETA
RLDCQVQGRPQPEVTWRINGIPVEELAKDQKYRIQRGALILSNVQPSDTMVTQCEARNRHGLLLANAYIY
VVQLPAKILTADNQTYMAVQGSTAYLLCKAFGAPVPSVQWLDEDGTTVLQDERFFPYANGTLGIRDLQAN
DTGRYFCLAANDQNNVTIMANLKVKDATQITQGPRSTIEKKGSRVTFTCQASFDPSLQPSITWRGDGRDL
QELGDSDKYFIEDGRLVIHSLDYSDQGNYSCVASTELDVVESRAQLLVVGSPGPVPRLVLSDLHLLTQSQ
VRVSWSPAEDHNAPIEKYDIEFEDKEMAPEKWYSLGKVPGNQTSTTLKLSPYVHYTFRVTAINKYGPGEP
SPVSETVVTPEAAPEKNPVDVKGEGNETTNMVITWKPLRWMDWNAPQVQYRVQWRPQGTRGPWQEQIVSD
PFLVVSNTSTFVPYEIKVQAVNSQGKGPEPQVTIGYSGEDYPQAIPELEGIEILNSSAVLVKWRPVDLAQ
VKGHLRGYNVTYWREGSQRKHSKRHIHKDHVVVPANTTSVILSGLRPYSSYHLEVQAFNGRGSGPASEFT
FSTPEGVPGHPEALHLECQSNTSLLLRWQPPLSHNGVLTGYVLSYHPLDEGGKGQLSFNLRDPELRTHNL
TDLSPHLRYRFQLQATTKEGPGEAIVREGGTMALSGISDFGNISATAGENYSVVSWVPKEGQCNFRFHIL
FKALGEEKGGASLSPQYVSYNQSSYTQWDLQPDTDYEIHLFKERMFRHQMAVKTNGTGRVRLPPAGFATE
GWFIGFVSAIILLLLVLLILCFIKRSKGGKYSVKDKEDTQVDSEARPMKDETFGEYRSLESDNEEKAFGS
SQPSLNGDIKPLGSDDSLADYGGSVDVQFNEDGSFIGQYSGKKEKEAAGGNDSSGATSPINPAVALE

myc-FLAG tag
Chromatograms CHROMATOGRAMS
Sequencher program is needed, download here.
Restriction Sites SgfI-MluI      Cloning Scheme for this gene      Plasmid Map     
ACCN NM_000425
ORF Size 3771 bp
OTI Disclaimer The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Product Components The ORF clone is ion-exchange column purified and shipped in a 2D barcoded Matrix tube containing 10ug of transfection-ready, dried plasmid DNA (reconstitute with 100 ul of water).
Reconstitution 1. Centrifuge at 5,000xg for 5min.
2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA.
3. Close the tube and incubate for 10 minutes at room temperature.
4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom.
5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C.
Reference Data
RefSeq NM_000425.5
RefSeq Size 4525 bp
RefSeq ORF 3774 bp
Locus ID 3897
UniProt ID P32004
Cytogenetics Xq28
Domains ig, IGc2, IG, FN3
Protein Families Druggable Genome, ES Cell Differentiation/IPS, Transmembrane
Protein Pathways Axon guidance, Cell adhesion molecules (CAMs)
MW 140 kDa
Gene Summary The protein encoded by this gene is an axonal glycoprotein belonging to the immunoglobulin supergene family. The ectodomain, consisting of several immunoglobulin-like domains and fibronectin-like repeats (type III), is linked via a single transmembrane sequence to a conserved cytoplasmic domain. This cell adhesion molecule plays an important role in nervous system development, including neuronal migration and differentiation. Mutations in the gene cause X-linked neurological syndromes known as CRASH (corpus callosum hypoplasia, retardation, aphasia, spastic paraplegia and hydrocephalus). Alternative splicing of this gene results in multiple transcript variants, some of which include an alternate exon that is considered to be specific to neurons. [provided by RefSeq, May 2013]
Other products for "L1CAM"
Customer Reviews 
Loading...
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.