GABA A Receptor gamma 2(GABRG2) (NM_000816) Human Tagged ORF Clone

CAT#: RC211528

GABRG2 (Myc-DDK-tagged)-Human gamma-aminobutyric acid (GABA) A receptor, gamma 2 (GABRG2), transcript variant 2

  • TrueORF®

Need custom modification / cloning service?
Get a free quote

USD 598.00


Availability*
In Stock

Size
    • 10 ug

Cited in 2 publications.

Product images

Specifications

Product Data
Product Name GABA A Receptor gamma 2(GABRG2) (NM_000816) Human Tagged ORF Clone
Symbol GABRG2
Synonyms CAE2; ECA2; GEFSP3
Vector pCMV6-Entry
Sequence Data
>RC211528 representing NM_000816
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGAGTTCGCCAAATATATGGAGCACAGGAAGCTCAGTCTACTCGACTCCTGTATTTTCACAGAAAATGA
CGGTGTGGATTCTGCTCCTGCTGTCGCTCTACCCTGGCTTCACTAGCCAGAAATCTGATGATGACTATGA
AGATTATGCTTCTAACAAAACATGGGTCTTGACTCCAAAAGTTCCTGAGGGTGATGTCACTGTCATCTTA
AACAACCTGCTGGAAGGATATGACAATAAACTTCGGCCTGATATAGGAGTGAAGCCAACGTTAATTCACA
CAGACATGTATGTGAATAGCATTGGTCCAGTGAACGCTATCAATATGGAATACACTATTGATATATTTTT
TGCGCAAACGTGGTATGACAGACGTTTGAAATTTAACAGCACCATTAAAGTCCTCCGATTGAACAGCAAC
ATGGTGGGGAAAATCTGGATTCCAGACACTTTCTTCAGAAATTCCAAAAAAGCTGATGCACACTGGATCA
CCACCCCCAACAGGATGCTGAGAATTTGGAATGATGGTCGAGTGCTCTACACCCTAAGGTTGACAATTGA
TGCTGAGTGCCAATTACAATTGCACAACTTTCCAATGGATGAACACTCCTGCCCCTTGGAGTTCTCCAGT
TATGGCTATCCACGTGAAGAAATTGTTTATCAATGGAAGCGAAGTTCTGTTGAAGTGGGCGACACAAGAT
CCTGGAGGCTTTATCAATTCTCATTTGTTGGTCTAAGAAATACCACCGAAGTAGTGAAGACAACTTCCGG
AGATTATGTGGTCATGTCTGTCTACTTTGATCTGAGCAGAAGAATGGGATACTTTACCATCCAGACCTAT
ATCCCCTGCACACTCATTGTCGTCCTATCCTGGGTGTCTTTCTGGATCAATAAGGATGCTGTTCCAGCCA
GAACATCTTTAGGTATCACCACTGTCCTGACAATGACCACCCTCAGCACCATTGCCCGGAAATCGCTCCC
CAAGGTCTCCTATGTCACAGCGATGGATCTCTTTGTATCTGTTTGTTTCATCTTTGTCTTCTCTGCTCTG
GTGGAGTATGGCACCTTGCATTATTTTGTCAGCAACCGGAAACCAAGCAAGGACAAAGATAAAAAGAAGA
AAAACCCTGCCCCTACCATTGATATCCGCCCAAGATCAGCAACCATTCAAATGAATAATGCTACACACCT
TCAAGAGAGAGATGAAGAGTACGGCTATGAGTGTCTGGACGGCAAGGACTGTGCCAGTTTTTTCTGCTGT
TTTGAAGATTGTCGAACAGGAGCTTGGAGACATGGGAGGATACATATCCGCATTGCCAAAATGGACTCCT
ATGCTCGGATCTTCTTCCCCACTGCCTTCTGCCTGTTTAATCTGGTCTATTGGGTCTCCTACCTCTACCT
G


ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT
ACAAGGATGACGACGATAAG
GTTTAA
>RC211528 representing NM_000816
Red=Cloning site Green=Tags(s)

MSSPNIWSTGSSVYSTPVFSQKMTVWILLLLSLYPGFTSQKSDDDYEDYASNKTWVLTPKVPEGDVTVIL
NNLLEGYDNKLRPDIGVKPTLIHTDMYVNSIGPVNAINMEYTIDIFFAQTWYDRRLKFNSTIKVLRLNSN
MVGKIWIPDTFFRNSKKADAHWITTPNRMLRIWNDGRVLYTLRLTIDAECQLQLHNFPMDEHSCPLEFSS
YGYPREEIVYQWKRSSVEVGDTRSWRLYQFSFVGLRNTTEVVKTTSGDYVVMSVYFDLSRRMGYFTIQTY
IPCTLIVVLSWVSFWINKDAVPARTSLGITTVLTMTTLSTIARKSLPKVSYVTAMDLFVSVCFIFVFSAL
VEYGTLHYFVSNRKPSKDKDKKKKNPAPTIDIRPRSATIQMNNATHLQERDEEYGYECLDGKDCASFFCC
FEDCRTGAWRHGRIHIRIAKMDSYARIFFPTAFCLFNLVYWVSYLYL

myc-FLAG tag
Chromatograms CHROMATOGRAMS
Sequencher program is needed, download here.
Restriction Sites SgfI-MluI      Cloning Scheme for this gene      Plasmid Map     
Tag Myc-DDK
ACCN NM_000816
ORF Size 1401 bp
OTI Disclaimer The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Product Components The ORF clone is ion-exchange column purified, transfection-ready dried plasmid DNA, and shipped with 2 vector sequencing primers.
Reference Data
RefSeq NM_000816.1, NM_000816.2, NM_000816.3, NP_000807
RefSeq Size 2370
RefSeq ORF 1404
Locus ID 2566
Cytogenetics 5q34
Domains Neur_chan_memb, Neur_chan_LBD
Protein Families Ion Channels: Cys-loop Receptors, Transmembrane, Druggable Genome
Protein Pathways Neuroactive ligand-receptor interaction
MW 54.16 kDa
Gene Summary This gene encodes a gamma-aminobutyric acid (GABA) receptor. GABA is the major inhibitory neurotransmitter in the mammlian brain, where it acts at GABA-A receptors, which are ligand-gated chloride channels. GABA-A receptors are pentameric, consisting of proteins from several subunit classes: alpha, beta, gamma, delta and rho. Mutations in this gene have been associated with epilepsy and febrile seizures. Multiple transcript variants encoding different isoforms have been identified for this gene. [provided by RefSeq, Jul 2008].
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Citations (2)