HDAC4(HDAC4) (NM_006037) Human Tagged ORF Clone

CAT#: RC211495

HDAC4 (Myc-DDK-tagged)-Human histone deacetylase 4 (HDAC4)

Clone Modification / Custom Cloning Service

USD 1,659.00


Availability*
In Stock

Size
    • 10 ug

Product images

Specifications

Product Data
Product Name HDAC4(HDAC4) (NM_006037) Human Tagged ORF Clone
Symbol HDAC4
Synonyms AHO3; BDMR; HA6116; HD4; HDAC-4; HDAC-A; HDACA
Vector pCMV6-Entry
Sequence Data
>RC211495 representing NM_006037
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGAGCTCCCAAAGCCATCCAGATGGACTTTCTGGCCGAGACCAGCCAGTGGAGCTGCTGAATCCTGCCC
GCGTGAACCACATGCCCAGCACGGTGGATGTGGCCACGGCGCTGCCTCTGCAAGTGGCCCCCTCGGCAGT
GCCCATGGACCTGCGCCTGGACCACCAGTTCTCACTGCCTGTGGCAGAGCCGGCCCTGCGGGAGCAGCAG
CTGCAGCAGGAGCTCCTGGCGCTCAAGCAGAAGCAGCAGATCCAGAGGCAGATCCTCATCGCTGAGTTCC
AGAGGCAGCACGAGCAGCTCTCCCGGCAGCACGAGGCGCAGCTCCACGAGCACATCAAGCAACAACAGGA
GATGCTGGCCATGAAGCACCAGCAGGAGCTGCTGGAACACCAGCGGAAGCTGGAGAGGCACCGCCAGGAG
CAGGAGCTGGAGAAGCAGCACCGGGAGCAGAAGCTGCAGCAGCTCAAGAACAAGGAGAAGGGCAAAGAGA
GTGCCGTGGCCAGCACAGAAGTGAAGATGAAGTTACAAGAATTTGTCCTCAATAAAAAGAAGGCGCTGGC
CCACCGGAATCTGAACCACTGCATTTCCAGCGACCCTCGCTACTGGTACGGGAAAACGCAGCACAGTTCC
CTTGACCAGAGTTCTCCACCCCAGAGCGGAGTGTCGACCTCCTATAACCACCCGGTCCTGGGAATGTACG
ACGCCAAAGATGACTTCCCTCTTAGGAAAACAGCTTCTGAACCGAATCTGAAATTACGGTCCAGGCTAAA
GCAGAAAGTGGCCGAAAGACGGAGCAGCCCCCTGTTACGCAGGAAAGACGGGCCAGTGGTCACTGCTCTA
AAAAAGCGTCCGTTGGATGTCACAGACTCCGCGTGCAGCAGCGCCCCAGGCTCCGGACCCAGCTCACCCA
ACAACAGCTCCGGGAGCGTCAGCGCGGAGAACGGTATCGCGCCCGCCGTCCCCAGCATCCCGGCGGAGAC
GAGTTTGGCGCACAGACTTGTGGCACGAGAAGGCTCGGCCGCTCCACTTCCCCTCTACACATCGCCATCC
TTGCCCAACATCACGCTGGGCCTGCCTGCCACCGGCCCCTCTGCGGGCACGGCGGGCCAGCAGGACGCCG
AGAGACTCACCCTTCCCGCCCTCCAGCAGAGGCTCTCCCTTTTCCCCGGCACCCACCTCACTCCCTACCT
GAGCACCTCGCCCTTGGAGCGGGACGGAGGGGCAGCGCACAGCCCTCTTCTGCAGCACATGGTCTTACTG
GAGCAGCCGCCGGCACAAGCACCCCTCGTCACAGGCCTGGGAGCACTGCCCCTCCACGCACAGTCCTTGG
TTGGTGCAGACCGGGTGTCCCCCTCCATCCACAAGCTGCGGCAGCACCGCCCACTGGGGCGGACCCAGTC
GGCCCCGCTGCCCCAGAACGCCCAGGCTCTGCAGCACCTGGTCATCCAGCAGCAGCATCAGCAGTTTCTG
GAGAAACACAAGCAGCAGTTCCAGCAGCAGCAACTGCAGATGAACAAGATCATCCCCAAGCCAAGCGAGC
CAGCCCGGCAGCCGGAGAGCCACCCGGAGGAGACGGAGGAGGAGCTCCGTGAGCACCAGGCTCTGCTGGA
CGAGCCCTACCTGGACCGGCTGCCGGGGCAGAAGGAGGCGCACGCACAGGCCGGCGTGCAGGTGAAGCAG
GAGCCCATTGAGAGCGATGAGGAAGAGGCAGAGCCCCCACGGGAGGTGGAGCCGGGCCAGCGCCAGCCCA
GTGAGCAGGAGCTGCTCTTCAGACAGCAAGCCCTCCTGCTGGAGCAGCAGCGGATCCACCAGCTGAGGAA
CTACCAGGCGTCCATGGAGGCCGCCGGCATCCCCGTGTCCTTCGGCGGCCACAGGCCTCTGTCCCGGGCG
CAGTCCTCACCCGCGTCTGCCACCTTCCCCGTGTCTGTGCAGGAGCCCCCCACCAAGCCGAGGTTCACGA
CAGGCCTCGTGTATGACACGCTGATGCTGAAGCACCAGTGCACCTGCGGGAGTAGCAGCAGCCACCCCGA
GCACGCCGGGAGGATCCAGAGCATCTGGTCCCGCCTGCAGGAGACGGGCCTCCGGGGCAAATGCGAGTGC
ATCCGCGGACGCAAGGCCACCCTGGAGGAGCTACAGACGGTGCACTCGGAAGCCCACACCCTCCTGTATG
GCACGAACCCCCTCAACCGGCAGAAACTGGACAGTAAGAAACTTCTAGGCTCGCTCGCCTCCGTGTTCGT
CCGGCTCCCTTGCGGTGGTGTTGGGGTGGACAGTGACACCATATGGAACGAGGTGCACTCGGCGGGGGCA
GCCCGCCTGGCTGTGGGCTGCGTGGTAGAGCTGGTCTTCAAGGTGGCCACAGGGGAGCTGAAGAATGGCT
TTGCTGTGGTCCGCCCCCCTGGACACCATGCGGAGGAGAGCACGCCCATGGGCTTTTGCTACTTCAACTC
CGTGGCCGTGGCAGCCAAGCTTCTGCAGCAGAGGTTGAGCGTGAGCAAGATCCTCATCGTGGACTGGGAC
GTGCACCATGGAAACGGGACCCAGCAGGCTTTCTACAGCGACCCTAGCGTCCTGTACATGTCCCTCCACC
GCTACGACGATGGGAACTTCTTCCCAGGCAGCGGGGCTCCTGATGAGGTGGGCACAGGGCCCGGCGTGGG
TTTCAACGTCAACATGGCTTTCACCGGCGGCCTGGACCCCCCCATGGGAGACGCTGAGTACTTGGCGGCC
TTCAGAACGGTGGTCATGCCGATCGCCAGCGAGTTTGCCCCGGATGTGGTGCTGGTGTCATCAGGCTTCG
ATGCCGTGGAGGGCCACCCCACCCCTCTTGGGGGCTACAACCTCTCCGCCAGATGCTTCGGGTACCTGAC
GAAGCAGCTGATGGGCCTGGCTGGCGGCCGGATTGTCCTGGCCCTCGAGGGAGGCCACGACCTGACCGCC
ATTTGCGACGCCTCGGAAGCATGTGTTTCTGCCTTGCTGGGAAACGAGCTTGATCCTCTCCCAGAAAAGG
TTTTACAGCAAAGACCCAATGCAAACGCTGTCCGTTCCATGGAGAAAGTCATGGAGATCCACAGCAAGTA
CTGGCGCTGCCTGCAGCGCACAACCTCCACAGCGGGGCGTTCTCTGATCGAGGCTCAGACTTGCGAGAAC
GAAGAAGCCGAGACGGTCACCGCCATGGCCTCGCTGTCCGTGGGCGTGAAGCCCGCCGAAAAGAGACCAG
ATGAGGAGCCCATGGAAGAGGAGCCGCCCCTG


ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT
ACAAGGATGACGACGATAAG
GTTTAA
>RC211495 representing NM_006037
Red=Cloning site Green=Tags(s)

MSSQSHPDGLSGRDQPVELLNPARVNHMPSTVDVATALPLQVAPSAVPMDLRLDHQFSLPVAEPALREQQ
LQQELLALKQKQQIQRQILIAEFQRQHEQLSRQHEAQLHEHIKQQQEMLAMKHQQELLEHQRKLERHRQE
QELEKQHREQKLQQLKNKEKGKESAVASTEVKMKLQEFVLNKKKALAHRNLNHCISSDPRYWYGKTQHSS
LDQSSPPQSGVSTSYNHPVLGMYDAKDDFPLRKTASEPNLKLRSRLKQKVAERRSSPLLRRKDGPVVTAL
KKRPLDVTDSACSSAPGSGPSSPNNSSGSVSAENGIAPAVPSIPAETSLAHRLVAREGSAAPLPLYTSPS
LPNITLGLPATGPSAGTAGQQDAERLTLPALQQRLSLFPGTHLTPYLSTSPLERDGGAAHSPLLQHMVLL
EQPPAQAPLVTGLGALPLHAQSLVGADRVSPSIHKLRQHRPLGRTQSAPLPQNAQALQHLVIQQQHQQFL
EKHKQQFQQQQLQMNKIIPKPSEPARQPESHPEETEEELREHQALLDEPYLDRLPGQKEAHAQAGVQVKQ
EPIESDEEEAEPPREVEPGQRQPSEQELLFRQQALLLEQQRIHQLRNYQASMEAAGIPVSFGGHRPLSRA
QSSPASATFPVSVQEPPTKPRFTTGLVYDTLMLKHQCTCGSSSSHPEHAGRIQSIWSRLQETGLRGKCEC
IRGRKATLEELQTVHSEAHTLLYGTNPLNRQKLDSKKLLGSLASVFVRLPCGGVGVDSDTIWNEVHSAGA
ARLAVGCVVELVFKVATGELKNGFAVVRPPGHHAEESTPMGFCYFNSVAVAAKLLQQRLSVSKILIVDWD
VHHGNGTQQAFYSDPSVLYMSLHRYDDGNFFPGSGAPDEVGTGPGVGFNVNMAFTGGLDPPMGDAEYLAA
FRTVVMPIASEFAPDVVLVSSGFDAVEGHPTPLGGYNLSARCFGYLTKQLMGLAGGRIVLALEGGHDLTA
ICDASEACVSALLGNELDPLPEKVLQQRPNANAVRSMEKVMEIHSKYWRCLQRTTSTAGRSLIEAQTCEN
EEAETVTAMASLSVGVKPAEKRPDEEPMEEEPPL

myc-FLAG tag
Chromatograms CHROMATOGRAMS
Sequencher program is needed, download here.
Restriction Sites SgfI-MluI      Cloning Scheme for this gene      Plasmid Map     
Tag Myc-DDK
ACCN NM_006037
ORF Size 3252 bp
OTI Disclaimer Due to the inherent nature of this plasmid, standard methods to replicate additional amounts of DNA in E. coli are highly likely to result in mutations and/or rearrangements. Therefore, OriGene does not guarantee the capability to replicate this plasmid DNA. Additional amounts of DNA can be purchased from OriGene with batch-specific, full-sequence verification at a reduced cost. Please contact our customer care team at custsupport@origene.com or by calling 301.340.3188 option 3 for pricing and delivery.

The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Product Components The ORF clone is ion-exchange column purified, transfection-ready dried plasmid DNA, and shipped with 2 vector sequencing primers.
Reference Data
RefSeq NM_006037.1, NM_006037.2, NM_006037.3, NP_006028
RefSeq Size 8459
RefSeq ORF 3255
Locus ID 9759
Cytogenetics 2q37.3
Domains Hist_deacetyl
Protein Families Transcription Factors, Druggable Genome
MW 118.9 kDa
Gene Summary Histones play a critical role in transcriptional regulation, cell cycle progression, and developmental events. Histone acetylation/deacetylation alters chromosome structure and affects transcription factor access to DNA. The protein encoded by this gene belongs to class II of the histone deacetylase/acuc/apha family. It possesses histone deacetylase activity and represses transcription when tethered to a promoter. This protein does not bind DNA directly, but through transcription factors MEF2C and MEF2D. It seems to interact in a multiprotein complex with RbAp48 and HDAC3. [provided by RefSeq, Jul 2008].
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Citations (1)