SWI5 (NM_001040011) Human Tagged ORF Clone

CAT#: RC211457

SWI5 (Myc-DDK-tagged)-Human chromosome 9 open reading frame 119 (C9orf119)

Change vector?

  • TrueORF®

USD 98

USD 390


Availability*
In Stock

Size
    • 10 ug

Product images

Specifications

Product Data
Product Name SWI5 (NM_001040011) Human Tagged ORF Clone
Symbol SWI5
Synonyms C9orf119; SAE3
Vector pCMV6-Entry
Sequence Data
ORF Nucleotide Sequence
>RC211457 representing NM_001040011
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGCAGCGGCGTGGCCAGAGGGACCTGTGGCGTCACAACAAAAGCTGCGCACGCAACCGCTGTCCCCGCC
CACCTCGGGAGAGGGGCGGGGCCGGCTTTCCTTGGGTGCGCGCGCAGCTTTCTGTGCGCCAGTTCACACT
CCGGGTCAGAGTTCCTGGCCCGGTGCACCTGAGAGGTCGCTCTCCGACTCCCGCGCTGGACCCTCTTGCG
CCATTGAACCCCCTGATCCGGGGGCCTCGGACCCCAGGGCTCAGGAGATGGATCCAGTCCCTGGCGCTCC
TACTTCCCAACTGCTCCTCCTCCCGCATCCCCACAGTACCCCGTCCTCACAGCGGGCTGTGGGTCCAATC
AGACTTTCCCCTCGGATTCCTCTCTAGGACTGAACCAAGACTTACCCGAAGTTGCCGCGGGGCCTTCCGA
TCCCCTAGGCCATTGCCCAAGTCTGGCCAGGCTGATGGGACCAGCGAGGAGTCTCTGCACCTTGACATTC
AGAAACTGAAGGAGAAGAGGGACATGCTGGACAAGGAGATCTCCCAGTTCGTATCTGAAGGCTACAGTGT
GGATGAACTGGAGGACCACATTACCCAGCTTCACGAGTACAATGACATCAAGGATGTGGGGCAGATGCTG
ATGGGCAAACTAGCTGTGATCCGAGGTGTCACCACCAAAGAGTTGTATCCAGAGTTTGGGCTGGACATGA
ATGAC


ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT
ACAAGGATGACGACGATAAG
GTTTAA
Protein Sequence
>RC211457 representing NM_001040011
Red=Cloning site Green=Tags(s)

MQRRGQRDLWRHNKSCARNRCPRPPRERGGAGFPWVRAQLSVRQFTLRVRVPGPVHLRGRSPTPALDPLA
PLNPLIRGPRTPGLRRWIQSLALLLPNCSSSRIPTVPRPHSGLWVQSDFPLGFLSRTEPRLTRSCRGAFR
SPRPLPKSGQADGTSEESLHLDIQKLKEKRDMLDKEISQFVSEGYSVDELEDHITQLHEYNDIKDVGQML
MGKLAVIRGVTTKELYPEFGLDMND

myc-FLAG tag
Chromatograms CHROMATOGRAMS
Sequencher program is needed, download here.
Restriction Sites SgfI-MluI      Cloning Scheme for this gene      Plasmid Map     
Tag Myc-DDK
ACCN NM_001040011
ORF Size 705 bp
OTI Disclaimer The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Product Components The ORF clone is ion-exchange column purified, transfection-ready dried plasmid DNA, and shipped with 2 vector sequencing primers.
Reference Data
RefSeq NM_001040011.1, NP_001035100
RefSeq Size 1004
RefSeq ORF 708
Locus ID 375757
Cytogenetics 9q34.11
MW 26.6 kDa
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Citations