ARID5B (NM_032199) Human Tagged ORF Clone

CAT#: RC211454

ARID5B (Myc-DDK-tagged)-Human AT rich interactive domain 5B (MRF1-like) (ARID5B)

Need custom modification / cloning service?
Get a free quote

USD 1,813.00


Availability*
In Stock

Size
    • 10 ug

Cited in 1 publication.

Product images

Specifications

Product Data
Product Name ARID5B (NM_032199) Human Tagged ORF Clone
Symbol ARID5B
Synonyms DESRT; MRF-2; MRF2
Vector pCMV6-Entry
Sequence Data
>RC211454 representing NM_032199
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGGAGCCCAACTCACTCCAGTGGGTCGGCTCACCGTGTGGCTTGCACGGACCTTACATTTTCTACAAGG
CTTTTCAATTCCACCTTGAAGGCAAACCAAGAATTTTGTCCCTTGGCGACTTTTTCTTTGTAAGATGTAC
GCCAAAGGATCCGATTTGCATAGCGGAGCTCCAGCTGTTGTGGGAAGAGAGGACCAGCCGGCAACTTTTA
TCCAGCTCTAAACTTTATTTCCTCCCAGAAGACACTCCCCAGGGCAGAAATAGCGACCATGGCGAGGATG
AAGTCATTGCTGTTTCCGAAAAGGTGATTGTGAAGCTTGAAGACCTGGTCAAGTGGGTACATTCTGATTT
CTCCAAGTGGAGATGTGGCTTCCACGCTGGACCAGTGAAAACTGAGGCCTTGGGAAGGAATGGACAGAAG
GAAGCTCTGCTGAAGTACAGGCAGTCAACCCTAAACAGTGGACTCAACTTCAAAGACGTTCTCAAGGAGA
AGGCAGACCTGGGGGAGGACGAGGAAGAAACGAACGTGATAGTTCTCAGCTACCCCCAGTACTGCCGGTA
CCGCTCGATGCTGAAACGCATCCAGGATAAGCCATCTTCCATTCTAACGGACCAGTTTGCATTGGCCCTG
GGGGGCATTGCAGTGGTCAGCAGGAACCCTCAGATCCTGTACTGTCGGGACACCTTTGACCACCCGACTC
TCATAGAAAACGAGAGTATATGCGATGAGTTTGCGCCAAATCTTAAAGGCAGACCACGCAAAAAGAAACC
ATGCCCACAAAGAAGAGATTCATTCAGTGGTGTTAAGGATTCCAACAACAATTCCGATGGCAAAGCCGTT
GCCAAGGTGAAATGTGAGGCCAGGTCAGCCTTGACCAAGCCGAAGAATAACCATAACTGTAAAAAAGTCT
CAAATGAAGAAAAACCAAAGGTTGCCATTGGTGAAGAGTGCAGGGCAGATGAACAAGCCTTCTTGGTGGC
ACTTTATAAATACATGAAAGAAAGGAAAACGCCGATAGAACGAATACCCTATTTAGGTTTTAAACAGATT
AACCTTTGGACTATGTTTCAAGCTGCTCAAAAACTGGGAGGATATGAAACAATAACAGCCCGCCGTCAGT
GGAAACATATTTATGATGAATTAGGCGGTAATCCTGGGAGCACCAGCGCTGCCACTTGTACCCGCAGACA
TTATGAAAGATTAATCCTACCATATGAAAGATTTATTAAAGGAGAAGAAGATAAGCCCCTGCCTCCAATC
AAACCTCGGAAACAGGAGAACAGTTCACAGGAAAATGAGAACAAAACAAAAGTATCTGGAACCAAACGCA
TCAAACATGAAATACCTAAAAGCAAGAAAGAAAAAGAAAATGCCCCAAAGCCCCAGGATGCAGCAGAGGT
TTCATCAGAGCAAGAAAAAGAACAAGAGACTTTAATAAGCCAGAAAAGCATCCCTGAGCCTCTCCCAGCA
GCAGACATGAAGAAAAAAATAGAAGGGTATCAGGAATTTTCAGCGAAGCCCCTGGCATCCAGAGTAGACC
CAGAGAAGGACAACGAAACAGACCAAGGTTCCAACAGTGAGAAGGTGGCAGAGGAGGCGGGAGAGAAGGG
GCCCACACCTCCACTCCCAAGTGCTCCTCTGGCCCCAGAAAAAGATTCAGCCTTGGTCCCTGGGGCCAGC
AAACAGCCACTCACCTCTCCTAGTGCCCTGGTGGACTCAAAACAAGAATCCAAACTGTGCTGTTTTACAG
AGAGCCCTGAAAGTGAACCCCAAGAAGCATCCTTCCCCAGCTTCCCCACCACACAGCCACCGCTGGCAAA
CCAGAATGAGACGGAGGATGACAAACTGCCCGCCATGGCAGATTACATTGCCAACTGCACCGTGAAGGTG
GACCAGCTGGGCAGTGACGACATCCACAATGCGCTCAAGCAGACCCCAAAGGTCCTTGTGGTCCAGTCGT
TTGACATGTTCAAAGACAAAGACCTGACTGGGCCCATGAACGAGAACCATGGACTTAATTACACGCCCCT
GCTCTACTCTAGGGGCAACCCAGGCATCATGTCCCCACTGGCCAAGAAAAAGCTTTTGTCCCAAGTGAGT
GGGGCCAGCCTCTCCAGCAGCTACCCTTATGGCTCCCCACCCCCTTTGATCAGCAAAAAGAAACTGATTG
CTAGGGATGACTTGTGTTCCAGTTTGTCCCAGACCCACCATGGCCAAAGCACTGACCATATGGCGGTCAG
CCGGCCATCAGTGATTCAGCACGTCCAGAGTTTCAGAAGCAAGCCCTCGGAAGAGAGAAAGACCATCAAT
GACATCTTTAAGCATGAGAAACTGAGTCGATCAGATCCCCACCGCTGCAGCTTCTCCAAGCATCACCTTA
ACCCCCTTGCTGACTCCTACGTCCTGAAGCAAGAAATTCAGGAGGGCAAGGATAAACTCTTAGAGAAAAG
GGCCCTCCCCCATTCCCACATGCCTAGCTTCCTGGCTGACTTCTACTCGTCCCCTCATCTCCATAGCCTC
TACAGACACACCGAGCACCATCTTCATAATGAACAGACATCCAAATACCCTTCCAGGGACATGTACAGGG
AATCGGAAAACAGTTCTTTTCCTTCCCACAGACACCAAGAAAAGCTCCATGTAAATTATCTCACGTCCCT
GCACCTGCAAGACAAAAAGTCGGCGGCAGCAGAAGCCCCTACGGATGATCAGCCTACAGATCTGAGCCTT
CCCAAGAACCCGCACAAACCTACCGGCAAGGTCCTGGGCCTGGCTCATTCCACCACAGGGCCCCAGGAGA
GCAAAGGCATCTCCCAGTTCCAGGTCTTAGGCAGCCAGAGTCGAGACTGTCACCCCAAAGCCTGTCGGGT
ATCACCCATGACCATGTCAGGCCCTAAAAAATACCCTGAATCGCTTTCAAGATCAGGAAAACCTCACCAT
GTGAGACTGGAGAATTTCAGGAAGATGGAAGGCATGGTCCACCCAATCCTGCACCGGAAAATGAGCCCGC
AGAACATTGGGGCGGCGCGGCCGATCAAGCGCAGCCTGGAGGATTTGGACCTTGTGATTGCAGGGAAAAA
GGCCCGGGCAGTGTCTCCCTTAGACCCATCCAAGGAGGTCTCTGGGAAGGAGAAGGCCTCTGAGCAGGAG
AGTGAAGGCAGCAAAGCAGCGCACGGTGGGCATTCCGGGGGCGGATCAGAAGGCCACAAGCTTCCCCTCT
CCTCCCCTATCTTCCCAGGTCTGTATTCCGGGAGCCTGTGTAACTCGGGCCTCAACTCCAGGCTCCCGGC
TGGGTATTCTCATTCTCTGCAGTACTTGAAAAACCAGACTGTGCTTTCTCCACTCATGCAGCCCCTGGCT
TTCCACTCGCTTGTGATGCAAAGAGGAATTTTTACATCACCGACAAATTCTCAGCAGCTGTACAGACACT
TGGCTGCGGCTACACCTGTAGGAAGTTCATATGGGGACCTTTTGCATAACAGCATTTACCCTTTAGCTGC
TATAAATCCTCAAGCTGCCTTTCCATCTTCCCAGCTGTCATCCGTGCACCCCAGTACAAAACTG


ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT
ACAAGGATGACGACGATAAG
GTTTAA
>RC211454 representing NM_032199
Red=Cloning site Green=Tags(s)

MEPNSLQWVGSPCGLHGPYIFYKAFQFHLEGKPRILSLGDFFFVRCTPKDPICIAELQLLWEERTSRQLL
SSSKLYFLPEDTPQGRNSDHGEDEVIAVSEKVIVKLEDLVKWVHSDFSKWRCGFHAGPVKTEALGRNGQK
EALLKYRQSTLNSGLNFKDVLKEKADLGEDEEETNVIVLSYPQYCRYRSMLKRIQDKPSSILTDQFALAL
GGIAVVSRNPQILYCRDTFDHPTLIENESICDEFAPNLKGRPRKKKPCPQRRDSFSGVKDSNNNSDGKAV
AKVKCEARSALTKPKNNHNCKKVSNEEKPKVAIGEECRADEQAFLVALYKYMKERKTPIERIPYLGFKQI
NLWTMFQAAQKLGGYETITARRQWKHIYDELGGNPGSTSAATCTRRHYERLILPYERFIKGEEDKPLPPI
KPRKQENSSQENENKTKVSGTKRIKHEIPKSKKEKENAPKPQDAAEVSSEQEKEQETLISQKSIPEPLPA
ADMKKKIEGYQEFSAKPLASRVDPEKDNETDQGSNSEKVAEEAGEKGPTPPLPSAPLAPEKDSALVPGAS
KQPLTSPSALVDSKQESKLCCFTESPESEPQEASFPSFPTTQPPLANQNETEDDKLPAMADYIANCTVKV
DQLGSDDIHNALKQTPKVLVVQSFDMFKDKDLTGPMNENHGLNYTPLLYSRGNPGIMSPLAKKKLLSQVS
GASLSSSYPYGSPPPLISKKKLIARDDLCSSLSQTHHGQSTDHMAVSRPSVIQHVQSFRSKPSEERKTIN
DIFKHEKLSRSDPHRCSFSKHHLNPLADSYVLKQEIQEGKDKLLEKRALPHSHMPSFLADFYSSPHLHSL
YRHTEHHLHNEQTSKYPSRDMYRESENSSFPSHRHQEKLHVNYLTSLHLQDKKSAAAEAPTDDQPTDLSL
PKNPHKPTGKVLGLAHSTTGPQESKGISQFQVLGSQSRDCHPKACRVSPMTMSGPKKYPESLSRSGKPHH
VRLENFRKMEGMVHPILHRKMSPQNIGAARPIKRSLEDLDLVIAGKKARAVSPLDPSKEVSGKEKASEQE
SEGSKAAHGGHSGGGSEGHKLPLSSPIFPGLYSGSLCNSGLNSRLPAGYSHSLQYLKNQTVLSPLMQPLA
FHSLVMQRGIFTSPTNSQQLYRHLAAATPVGSSYGDLLHNSIYPLAAINPQAAFPSSQLSSVHPSTKL

myc-FLAG tag
Chromatograms CHROMATOGRAMS
Sequencher program is needed, download here.
Restriction Sites SgfI-MluI      Cloning Scheme for this gene      Plasmid Map     
Tag Myc-DDK
ACCN NM_032199
ORF Size 3564 bp
OTI Disclaimer The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Product Components The ORF clone is ion-exchange column purified, transfection-ready dried plasmid DNA, and shipped with 2 vector sequencing primers.
Reference Data
RefSeq NM_032199.1, NM_032199.2, NP_115575
RefSeq Size 7507
RefSeq ORF 3567
Locus ID 84159
Cytogenetics 10q21.2
MW 132.2 kDa
Gene Summary This gene encodes a member of the AT-rich interaction domain (ARID) family of DNA binding proteins. The encoded protein forms a histone H3K9Me2 demethylase complex with PHD finger protein 2 and regulates the transcription of target genes involved in adipogenesis and liver development. This gene also plays a role in cell growth and differentiation of B-lymphocyte progenitors, and single nucleotide polymorphisms in this gene are associated with acute lymphoblastic leukemia. Alternatively spliced transcript variants encoding multiple isoforms have been observed for this gene. [provided by RefSeq, Sep 2011].
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Citations (1)