GDF6 (NM_001001557) Human Tagged ORF Clone

CAT#: RC211366

GDF6 (Myc-DDK-tagged)-Human growth differentiation factor 6 (GDF6)

Clone Modification / Custom Cloning Service

  • TrueORF®

USD 577.00


Availability*
In Stock

Size
    • 10 ug

Product images

Specifications

Product Data
Product Name GDF6 (NM_001001557) Human Tagged ORF Clone
Symbol GDF6
Synonyms BMP-13; BMP13; CDMP2; KFM; KFS; KFS1; KFSL; SGM1
Vector pCMV6-Entry
Sequence Data
>RC211366 representing NM_001001557
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGGATACTCCCAGGGTCCTGCTCTCGGCCGTCTTCCTCATCAGTTTTCTGTGGGATTTGCCCGGTTTCC
AGCAGGCTTCCATCTCATCCTCCTCGTCGTCCGCCGAGCTGGGTTCCACCAAGGGCATGCGAAGCCGCAA
GGAAGGCAAGATGCAGCGGGCGCCGCGCGACAGTGACGCGGGCCGGGAGGGCCAGGAACCACAGCCGCGG
CCTCAGGACGAACCCCGGGCTCAGCAGCCCCGGGCGCAGGAGCCGCCAGGCAGGGGTCCGCGCGTGGTGC
CCCACGAGTACATGCTGTCAATCTACAGGACTTACTCCATCGCTGAGAAGCTGGGCATCAATGCCAGCTT
TTTCCAGTCTTCCAAGTCGGCTAATACGATCACCAGCTTTGTAGACAGGGGACTAGACGATCTCTCGCAC
ACTCCTCTCCGGAGACAGAAGTATTTGTTTGATGTGTCCATGCTCTCAGACAAAGAAGAGCTGGTGGGCG
CGGAGCTGCGGCTCTTTCGCCAGGCGCCCTCAGCGCCCTGGGGGCCACCAGCCGGGCCGCTCCACGTGCA
GCTCTTCCCTTGCCTTTCGCCCCTACTGCTGGACGCGCGGACCCTGGACCCGCAGGGGGCGCCGCCGGCC
GGCTGGGAAGTCTTCGACGTGTGGCAGGGCCTGCGCCACCAGCCCTGGAAGCAGCTGTGCTTGGAGCTGC
GGGCCGCATGGGGCGAGCTGGACGCCGGGGAGGCCGAGGCGCGCGCGCGGGGACCCCAGCAACCGCCGCC
CCCGGACCTGCGGAGTCTGGGCTTCGGCCGGAGGGTGCGGCCTCCCCAGGAGCGGGCCCTGCTGGTGGTA
TTCACCAGATCCCAGCGCAAGAACCTGTTCGCAGAGATGCGCGAGCAGCTGGGCTCGGCCGAGGCTGCGG
GCCCGGGCGCGGGCGCCGAGGGGTCGTGGCCGCCGCCGTCGGGCGCCCCGGATGCCAGGCCTTGGCTGCC
CTCGCCCGGCCGCCGGCGGCGGCGCACGGCCTTCGCCAGTCGCCATGGCAAGCGGCACGGCAAGAAGTCC
AGGCTACGCTGCAGCAAGAAGCCCCTGCACGTGAACTTCAAGGAGCTGGGCTGGGACGACTGGATTATCG
CGCCCCTGGAGTACGAGGCCTATCACTGCGAGGGTGTATGCGACTTCCCGCTGCGCTCGCACCTGGAGCC
CACCAACCACGCCATCATCCAGACGCTGATGAACTCCATGGACCCCGGCTCCACCCCGCCCAGCTGCTGC
GTGCCCACCAAATTGACTCCCATCAGCATTCTATACATCGACGCGGGCAATAATGTGGTCTACAAGCAGT
ACGAGGACATGGTGGTGGAGTCGTGCGGCTGCAGG


ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT
ACAAGGATGACGACGATAAG
GTTTAA
>RC211366 representing NM_001001557
Red=Cloning site Green=Tags(s)

MDTPRVLLSAVFLISFLWDLPGFQQASISSSSSSAELGSTKGMRSRKEGKMQRAPRDSDAGREGQEPQPR
PQDEPRAQQPRAQEPPGRGPRVVPHEYMLSIYRTYSIAEKLGINASFFQSSKSANTITSFVDRGLDDLSH
TPLRRQKYLFDVSMLSDKEELVGAELRLFRQAPSAPWGPPAGPLHVQLFPCLSPLLLDARTLDPQGAPPA
GWEVFDVWQGLRHQPWKQLCLELRAAWGELDAGEAEARARGPQQPPPPDLRSLGFGRRVRPPQERALLVV
FTRSQRKNLFAEMREQLGSAEAAGPGAGAEGSWPPPSGAPDARPWLPSPGRRRRRTAFASRHGKRHGKKS
RLRCSKKPLHVNFKELGWDDWIIAPLEYEAYHCEGVCDFPLRSHLEPTNHAIIQTLMNSMDPGSTPPSCC
VPTKLTPISILYIDAGNNVVYKQYEDMVVESCGCR

myc-FLAG tag
Chromatograms CHROMATOGRAMS
Sequencher program is needed, download here.
Restriction Sites SgfI-MluI      Cloning Scheme for this gene      Plasmid Map     
Tag Myc-DDK
ACCN NM_001001557
ORF Size 1365 bp
OTI Disclaimer Due to the inherent nature of this plasmid, standard methods to replicate additional amounts of DNA in E. coli are highly likely to result in mutations and/or rearrangements. Therefore, OriGene does not guarantee the capability to replicate this plasmid DNA. Additional amounts of DNA can be purchased from OriGene with batch-specific, full-sequence verification at a reduced cost. Please contact our customer care team at custsupport@origene.com or by calling 301.340.3188 option 3 for pricing and delivery.

The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Product Components The ORF clone is ion-exchange column purified, transfection-ready dried plasmid DNA, and shipped with 2 vector sequencing primers.
Reference Data
RefSeq NM_001001557.1, NM_001001557.2, NM_001001557.3, NP_001001557
RefSeq Size 3716
RefSeq ORF 1368
Locus ID 392255
Cytogenetics 8q22.1
Protein Families Secreted Protein, Druggable Genome
Protein Pathways TGF-beta signaling pathway
MW 50.66 kDa
Gene Summary This gene encodes a secreted ligand of the TGF-beta (transforming growth factor-beta) superfamily of proteins. Ligands of this family bind various TGF-beta receptors leading to recruitment and activation of SMAD family transcription factors that regulate gene expression. The encoded preproprotein is proteolytically processed to generate each subunit of the disulfide-linked homodimer. This protein is required for normal formation of some bones and joints in the limbs, skull, and axial skeleton. Mutations in this gene are associated with Klippel-Feil syndrome, microphthalmia, and Leber congenital amaurosis. [provided by RefSeq, Sep 2016].
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Citations (1)