Casein Kinase 2 beta (CSNK2B) (NM_001320) Human Tagged ORF Clone

CAT#: RC211299

Reviews ()
Write a review

CSNK2B (Myc-DDK-tagged)-Human casein kinase 2, beta polypeptide (CSNK2B)


Product Datasheet for 'RC211299'


  "NM_001320" in other vectors (6)

USD 98.00

USD 390.00


Availability*
In Stock

Size
    • 10 ug


Product images

Specifications

Product Data
Product Name Casein Kinase 2 beta (CSNK2B) (NM_001320) Human Tagged ORF Clone
Type Human Tagged ORF Clone
Tag Myc-DDK
Symbol CSNK2B
Synonyms CK2B; CK2N; Ckb1; Ckb2; CSK2B; G5A
Vector pCMV6-Entry
E. coli Selection Kanamycin (25 ug/mL)
Cell Selection Neomycin
Sequence Data
>RC211299 ORF sequence
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGAGCAGCTCAGAGGAGGTGTCCTGGATTTCCTGGTTCTGTGGGCTCCGTGGCAATGAATTCTTCTGTG
AAGTGGATGAAGACTACATCCAGGACAAATTTAATCTTACTGGACTCAATGAGCAGGTCCCTCACTATCG
ACAAGCTCTAGACATGATCTTGGACCTGGAGCCTGATGAAGAACTGGAAGACAACCCCAACCAGAGTGAC
CTGATTGAGCAGGCAGCCGAGATGCTTTATGGATTGATCCACGCCCGCTACATCCTTACCAACCGTGGCA
TCGCCCAGATGTTGGAAAAGTACCAGCAAGGAGACTTTGGTTACTGTCCTCGTGTGTACTGTGAGAACCA
GCCAATGCTTCCCATTGGCCTTTCAGACATCCCAGGTGAAGCCATGGTGAAGCTCTACTGCCCCAAGTGC
ATGGATGTGTACACACCCAAGTCATCAAGACACCATCACACGGATGGCGCCTACTTCGGCACTGGTTTCC
CTCACATGCTCTTCATGGTGCATCCCGAGTACCGGCCCAAGAGACCTGCCAACCAGTTTGTGCCCAGGCT
CTACGGTTTCAAGATCCATCCGATGGCCTACCAGCTGCAGCTCCAAGCCGCCAGCAACTTCAAGAGCCCA
GTCAAGACGATTCGC


ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT
ACAAGGATGACGACGATAAG
GTTTAA
>RC211299 protein sequence
Red=Cloning site Green=Tags(s)

MSSSEEVSWISWFCGLRGNEFFCEVDEDYIQDKFNLTGLNEQVPHYRQALDMILDLEPDEELEDNPNQSD
LIEQAAEMLYGLIHARYILTNRGIAQMLEKYQQGDFGYCPRVYCENQPMLPIGLSDIPGEAMVKLYCPKC
MDVYTPKSSRHHHTDGAYFGTGFPHMLFMVHPEYRPKRPANQFVPRLYGFKIHPMAYQLQLQAASNFKSP
VKTIR

myc-FLAG tag
Chromatograms CHROMATOGRAMS
Sequencher program is needed, download here.
Restriction Sites SgfI-MluI      Cloning Scheme for this gene      Plasmid Map     
Tag Myc-DDK
ACCN NM_001320
ORF Size 645 bp
OTI Disclaimer Due to the inherent nature of this plasmid, standard methods to replicate additional amounts of DNA in E. coli are highly likely to result in mutations and/or rearrangements. Therefore, OriGene does not guarantee the capability to replicate this plasmid DNA. Additional amounts of DNA can be purchased from OriGene with batch-specific, full-sequence verification at a reduced cost. Please contact our customer care team at custsupport@origene.com or by calling 301.340.3188 option 3 for pricing and delivery.

The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Product Components The ORF clone is ion-exchange column purified, transfection-ready dried plasmid DNA, and shipped with 2 vector sequencing primers.
Reconstitution 1. Centrifuge at 5,000xg for 5min.
2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA.
3. Close the tube and incubate for 10 minutes at room temperature.
4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom.
5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C.
Reference Data
RefSeq NM_001320.1, NM_001320.2, NM_001320.3, NM_001320.4, NM_001320.5, NM_001320.6, NP_001311.3
RefSeq Size 1149
RefSeq ORF 648
Locus ID 1460
Cytogenetics 6p21.33
Domains CK_II_beta
Protein Families Druggable Genome
Protein Pathways Adherens junction, Tight junction, Wnt signaling pathway
MW 24.9 kDa
Gene Summary This gene encodes the beta subunit of casein kinase II, a ubiquitous protein kinase which regulates metabolic pathways, signal transduction, transcription, translation, and replication. The enzyme is composed of three subunits, alpha, alpha prime and beta, which form a tetrameric holoenzyme. The alpha and alpha prime subunits are catalytic, while the beta subunit serves regulatory functions. The enzyme localizes to the endoplasmic reticulum and the Golgi apparatus. Two transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq, Sep 2013]

Other Versions

Other products for "CSNK2B"
Frequently bought together (3)
Clone OTI4C5, Anti-DDK (FLAG) monoclonal antibody
    • 100 ul

USD 310.00


pCMV6-Entry, mammalian vector with C-terminal Myc- DDK Tag, 10ug
    • 10 ug

USD 570.00


Rabbit polyclonal anti-CSNK2B Antibody
    • 100 ul

USD 345.00

Customer Reviews 
Loading...
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.
68 Mouse Clones
Molbio tools