TTC19 (NM_017775) Human Tagged ORF Clone

CAT#: RC211271

Reviews ()
Write a review

TTC19 (Myc-DDK-tagged)-Human tetratricopeptide repeat domain 19 (TTC19), transcript variant 1



  "NM_017775" in other vectors (7)

Reconstitution Protocol

Special Offer: 20% off the control vector (empty cloning vector without insert). Use code "Shuttle20".

USD 477.00


Availability*
In Stock

Size
    • 10 ug


Product images

Specifications

Product Data
Type Human Tagged ORF Clone
Tag Myc-DDK
Symbol TTC19
Synonyms 2010204O13Rik; MC3DN2
Vector pCMV6-Entry
E. coli Selection Kanamycin (25 ug/mL)
Mammalian Cell Selection Neomycin
Sequence Data
>RC211271 representing NM_017775
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGGCGCAGCCACACACGACCTCGGTCCCGTACTTCGCGCGCTCTCCTGCACCGCCGCCGCCATCTCGCT
CAGGAGCTCCTCCACAACCGCCGGCAACACTACGGCCATCGCGCCGCAGGACACGCCCTCCACGACCGGC
GGACCGCCGCGACGCTCCAGCTGACTGCGCCTACCTGTGGAGGATCCTGACCCCCCGCCGGGGCAGGGCG
AGACGGAGTGACGTCGGGGCGCGTCATCGCGCGTGCGGACGCAGGGATGTCCTGCTCAGTCGTCAGGGCC
CGGCCAATCCGGAGGGCGCTCGGCGCGTGGTCGGGGGCCAGGAGCGCGTCTGGCCTGCAGTGCGCAGAGG
ACGCGGCGGGAGCATGTTCCGGCTCCTGAGCTGGAGCCTGGGCCGAGGCTTCCTGCGGGCCGCGGGGCGG
CGGTGCCGGGGCTGCTCCGCGCGCCTGCTCCCGGGGCTGGCAGGAGGTCCGGGGCCCGAGGTGCAGGTGC
CGCCATCCCGAGTCGCGCCGCACGGCCGGGGCCCAGGCCTGCTGCCGCTGCTGGCAGCGCTCGCCTGGTT
CTCGAGGCCCGCTGCGGCAGAGGAGGAGGAGCAGCAGGGAGCCGACGGGGCCGCTGCCGAGGACGGGGCG
GACGAGGCCGAGGCAGAGATCATCCAGCTGCTGAAGCGAGCCAAGTTGAGCATTATGAAAGATGAGCCAG
AAGAGGCTGAGTTAATTTTGCATGACGCTCTTCGTCTCGCCTATCAGACTGATAACAAGAAGGCCATCAC
TTACACTTATGATTTGATGGCCAACTTAGCATTTATACGGGGTCAGCTTGAAAATGCTGAACAACTTTTT
AAAGCAACAATGAGTTACCTCCTTGGAGGGGGCATGAAGCAGGAGGACAATGCAATAATTGAAATTTCCC
TAAAGCTGGCCAGTATCTATGCTGCGCAGAACAGACAGGAATTTGCTGTTGCTGGCTATGAATTCTGCAT
TTCAACTCTAGAGGAAAAAATTGAAAGAGAAAAGGAATTAGCAGAAGACATTATGTCAGTGGAAGAGAAA
GCCAATACCCACCTCCTCTTGGGCATGTGCTTAGACGCCTGTGCTCGCTACCTTCTGTTCTCCAAGCAGC
CGTCACAGGCACAAAGGATGTATGAAAAAGCTCTGCAGATTTCTGAAGAAATACAAGGAGAAAGACACCC
ACAGACCATTGTGCTGATGAGTGACCTGGCTACTACCCTGGATGCACAGGGCCGCTTTGATGAGGCCTAT
ATTTATATGCAAAGGGCATCAGATCTGGCAAGACAGATAAATCATCCTGAGCTACACATGGTACTCAGTA
ATCTAGCTGCAGTTTTGATGCACAGAGAACGATATACACAAGCAAAAGAGATCTACCAGGAAGCACTGAA
GCAAGCAAAGCTGAAAAAAGATGAAATTTCTGTACAACACATCAGGGAAGAGTTGGCTGAGCTGTCAAAG
AAAAGTAGACCTTTGACAAATTCTGTCAAGCTC


ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT
ACAAGGATGACGACGATAAG
GTTTAA
>RC211271 representing NM_017775
Red=Cloning site Green=Tags(s)

MAQPHTTSVPYFARSPAPPPPSRSGAPPQPPATLRPSRRRTRPPRPADRRDAPADCAYLWRILTPRRGRA
RRSDVGARHRACGRRDVLLSRQGPANPEGARRVVGGQERVWPAVRRGRGGSMFRLLSWSLGRGFLRAAGR
RCRGCSARLLPGLAGGPGPEVQVPPSRVAPHGRGPGLLPLLAALAWFSRPAAAEEEEQQGADGAAAEDGA
DEAEAEIIQLLKRAKLSIMKDEPEEAELILHDALRLAYQTDNKKAITYTYDLMANLAFIRGQLENAEQLF
KATMSYLLGGGMKQEDNAIIEISLKLASIYAAQNRQEFAVAGYEFCISTLEEKIEREKELAEDIMSVEEK
ANTHLLLGMCLDACARYLLFSKQPSQAQRMYEKALQISEEIQGERHPQTIVLMSDLATTLDAQGRFDEAY
IYMQRASDLARQINHPELHMVLSNLAAVLMHRERYTQAKEIYQEALKQAKLKKDEISVQHIREELAELSK
KSRPLTNSVKL

myc-FLAG tag
Chromatograms CHROMATOGRAMS
Sequencher program is needed, download here.
Restriction Sites SgfI-MluI      Cloning Scheme for this gene      Plasmid Map     
ACCN NM_017775
ORF Size 1503 bp
OTI Disclaimer The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Product Components The ORF clone is ion-exchange column purified and shipped in a 2D barcoded Matrix tube containing 10ug of transfection-ready, dried plasmid DNA (reconstitute with 100 ul of water).
Reconstitution 1. Centrifuge at 5,000xg for 5min.
2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA.
3. Close the tube and incubate for 10 minutes at room temperature.
4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom.
5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C.
Reference Data
RefSeq NM_017775.2, NP_060245.2
RefSeq Size 2784 bp
RefSeq ORF 1143 bp
Locus ID 54902
UniProt ID Q6DKK2
Cytogenetics 17p12
Domains TPR
MW 55.6 kDa
Gene Summary This gene encodes a protein with a tetratricopeptide repeat (TPR) domain containing several TPRs of about 34 aa each. These repeats are found in a variety of organisms including bacteria, fungi and plants, and are involved in a variety of functions including protein-protein interactions. This protein is embedded in the inner mitochondrial membrane and is involved in the formation of the mitochondrial respiratory chain III. It has also been suggested that this protein plays a role in cytokinesis. Mutations in this gene cause mitochondrial complex III deficiency. Alternatively spliced transcript variants have been found for this gene. [provided by RefSeq, Sep 2012]

Other Versions

Other products for "TTC19"
Frequently bought together (4)
Clone OTI4C5, Anti-DDK (FLAG) monoclonal antibody
    • 30 ul

USD 165.00


pCMV6-Entry, mammalian vector with C-terminal Myc- DDK Tag, 10ug
    • 10 ug

USD 627.00


DH5α Chemically Competent Cells (≥10^8 cfu/μg of pUC19 DNA)
    • 5 x 200 ul

USD 149.00


Forward sequencing primer VP1.5, Reverse sequencing primer XL39, 100pmoles each
    • 100 pmol

USD 55.00

Customer Reviews 
Loading...
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.