EXOC3L2 (NM_138568) Human Tagged ORF Clone

CAT#: RC211213

EXOC3L2 (Myc-DDK-tagged)-Human exocyst complex component 3-like 2 (EXOC3L2)

Change vector?

USD 577


Availability*
In Stock

Size
    • 10 ug

Product images

Specifications

Product Data
Product Name EXOC3L2 (NM_138568) Human Tagged ORF Clone
Symbol EXOC3L2
Synonyms XTP7; XTP7
Vector pCMV6-Entry
Sequence Data
ORF Nucleotide Sequence
>RC211213 representing NM_138568
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGGCCGCCCTGGAGAATGGGGAGCTGGGGCCCCTTCTCTCCCCTGGCACCCTGCGGGGTTTGGAGGATG
AATGCGTCACAGATGTTAAGGCTCAGACCCGGGCTGCCCTTCTCCGTGTGCTGCAGGAGGACGAAGAGCA
CTGGGGGAGCCTGGAGGACCAGCCCAGCAGCCTGGCCCAGGATGTGTGTGAGCTGCTGGAAGAGCACACA
GAGCGAGCACCCCGCATCAGCCAGGAGTTTGGGGAGCGGATGGCCCACTGCTGCCTAGGCGGGCTGGCAG
AGTTCCTGCAGAGCTTCCAGCAGCGTGTGGAGCGATTCCATGAGAACCCAGCAGTCCGGGAGATGCTACC
TGACACCTATATCAGCAAGACCATCGCCCTGGTCAACTGCGGCCCCCCACTGAGAGCTCTGGCCGAGCGC
CTGGCCCGGGTGGGGCCCCCAGAAAGCGAGCCGGCCCGGGAAGCATCTGCTAGTGCTCTGGACCATGTGA
CCCGGCTCTGCCACCGTGTCGTGGCCAACCTGCTGTTCCAGGAGCTGCAGCCACACTTCAACAAGCTGAT
GCGCCGGAAGTGGCTGAGCAGCCCGGAGGCCCTGGATGGCATCGTGGGCACGCTGGGTGCCCAGGCCCTG
GCCCTGCGCAGAATGCAGGACGAGCCTTACCAGGCGCTGGTAGCCGAGCTACACCGGCGGGCGCTGGTCG
AGTACGTGCGGCCCCTGCTCCGTGGGCGCCTGCGCTGCAGCTCGGCGCGGACCCGCAGCCGCGTGGCCGG
CAGGCTCCGGGAGGACGCGGCGCAACTGCAGAGGCTGTTCCGGCGGCTGGAGTCCCAGGCCTCGTGGCTG
GATGCCGTGGTGCCCCATTTGGCTGAAGTCATGCAGCTGGAAGACACGCCCAGCATCCAGGTGGAGGTGG
GAGTGTTGGTGCGCGACTACCCAGACATCAGGCAGAAGCACGTGGCAGCCCTCCTCGACATCCGTGGCCT
GCGCAACACAGCCGCCCGCCAGGAGATCCTGGCCGTGGCCCGGGACCTGGAACTCTCTGAGGAGGGAGCC
CTGTCACCCCCTCGGGACCGTGCCTTCTTTGCAGACATCCCTGTGCCCCGCCCATCTTTCTGTCTCAGCC
TCCCTCTCTTCCTGGGCCGCCTCCCCCTCTCCCGGCTGGCCAGGCCCAGTTTGGCCTGTCTGCCTCGGCC
CCGGCCTCCGTCTCTAGCGCGACCTCGGGCCCAGCGC


AGCGGACCGACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCC
TGGATTACAAGGATGACGACGATAAG
GTTTAA
Protein Sequence
>RC211213 representing NM_138568
Red=Cloning site Green=Tags(s)

MAALENGELGPLLSPGTLRGLEDECVTDVKAQTRAALLRVLQEDEEHWGSLEDQPSSLAQDVCELLEEHT
ERAPRISQEFGERMAHCCLGGLAEFLQSFQQRVERFHENPAVREMLPDTYISKTIALVNCGPPLRALAER
LARVGPPESEPAREASASALDHVTRLCHRVVANLLFQELQPHFNKLMRRKWLSSPEALDGIVGTLGAQAL
ALRRMQDEPYQALVAELHRRALVEYVRPLLRGRLRCSSARTRSRVAGRLREDAAQLQRLFRRLESQASWL
DAVVPHLAEVMQLEDTPSIQVEVGVLVRDYPDIRQKHVAALLDIRGLRNTAARQEILAVARDLELSEEGA
LSPPRDRAFFADIPVPRPSFCLSLPLFLGRLPLSRLARPSLACLPRPRPPSLARPRAQR

SGPTRTRRLEQKLISEEDLAANDILDYKDDDDKV
Chromatograms CHROMATOGRAMS
Sequencher program is needed, download here.
Restriction Sites SgfI-RsrII      Cloning Scheme for this gene      Plasmid Map     
Tag Myc-DDK
ACCN NM_138568
ORF Size 1227 bp
OTI Disclaimer The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Product Components The ORF clone is ion-exchange column purified, transfection-ready dried plasmid DNA, and shipped with 2 vector sequencing primers.
Reference Data
RefSeq NM_138568.2, NM_138568.3, NP_612635
RefSeq Size 1719
RefSeq ORF 1230
Locus ID 90332
Cytogenetics 19q13.32
MW 45.7 kDa
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Citations