PDE10A (NM_006661) Human Tagged ORF Clone

CAT#: RC211181

Reviews ()
Write a review

PDE10A (Myc-DDK-tagged)-Human phosphodiesterase 10A (PDE10A), transcript variant 2



  "NM_006661" in other vectors (6)

Special Offer: 20% off the control vector (empty cloning vector without insert). Use code "Shuttle20".

USD 477.00


Availability*
In Stock

Size
    • 10 ug


Product images

Specifications

Product Data
Type Human Tagged ORF Clone
Tag Myc-DDK
Symbol PDE10A
Synonyms ADSD2; HSPDE10A; IOLOD; LINC00473; PDE10A19
Vector pCMV6-Entry
E. coli Selection Kanamycin (25 ug/mL)
Mammalian Cell Selection Neomycin
Sequence Data
>RC211181 representing NM_006661
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGAGGATAGAAGAGAGGAAATCCCAACATTTAACAGGTTTGACAGATGAAAAAGTGAAGGCATATCTTT
CTCTTCACCCCCAGGTATTAGATGAATTTGTATCTGAAAGTGTTAGTGCAGAGACAGTAGAGAAATGGCT
GAAGAGGAAGAACAACAAATCAGAAGATGAATCAGCTCCTAAGGAAGTCAGCAGGTACCAAGATACGAAT
ATGCAGGGAGTTGTATATGAACTAAACAGCTATATAGAACAACGGTTGGACACAGGAGGAGACAACCAGC
TACTCCTCTATGAACTGAGCAGCATCATTAAAATAGCCACAAAAGCCGATGGATTTGCACTGTATTTCCT
TGGAGAGTGCAATAATAGCCTGTGTATATTCACGCCACCTGGGATAAAGGAAGGAAAACCCCGCCTCATC
CCTGCTGGGCCCATCACTCAGGGCACCACCGTCTCTGCTTATGTGGCCAAGTCCAGGAAAACACTGCTAG
TAGAAGACATCCTTGGAGATGAACGATTTCCAAGAGGTACTGGACTGGAATCAGGGACTCGTATCCAGTC
TGTTCTTTGCTTACCAATTGTCACTGCAATTGGTGACTTGATTGGTATTCTCGAGCTGTATCGGCACTGG
GGCAAAGAAGCCTTCTGTCTTAGTCACCAGGAGGTTGCAACAGCAAATCTTGCCTGGGCTTCAGTAGCAA
TACATCAGGTGCAGGTATGCAGAGGCCTTGCCAAACAGACAGAATTGAATGACTTCCTACTCGACGTATC
AAAAACATATTTTGATAACATAGTTGCAATAGATTCTCTACTTGAACACATAATGATATATGCAAAAAAC
CTGGTGAATGCCGATCGTTGTGCACTTTTCCAGGTGGACCATAAGAACAAGGAGTTATATTCAGACCTTT
TTGATATTGGAGAGGAAAAGGAAGGAAAACCTGTCTTCAAGAAGACCAAAGAGATAAGATTTTCAATTGA
GAAAGGAATTGCTGGCCAAGTAGCAAGAACAGGGGAAGTCCTGAACATTCCAGATGCCTATGCAGACCCA
CGCTTTAACAGAGAAGTAGACTTGTACACAGGCTACACCACGCGGAACATCCTGTGCATGCCCATCGTCA
GCCGAGGCAGCGTGATAGGTGTGGTGCAGATGGTCAACAAAATCAGTGGCAGTGCCTTCTCTAAAACAGA
TGAAAACAACTTCAAAATGTTTGCCGTCTTTTGTGCTTTAGCCTTACACTGTGCTAATATGTATCATAGA
ATTCGCCACTCAGAGTGCATTTACCGGGTAACGATGGAAAAGCTGTCCTACCATAGCATTTGTACTTCAG
AAGAGTGGCAAGGTCTCATGCAATTCACCCTTCCCGTGCGTCTCTGCAAAGAAATTGAATTATTCCACTT
TGACATTGGTCCTTTTGAAAACATGTGGCCTGGAATTTTTGTCTACATGGTTCATCGGTCCTGTGGGACA
TCCTGCTTTGAGCTTGAAAAGTTGTGTCGTTTTATTATGTCTGTGAAGAAGAACTATCGGCGGGTTCCTT
ATCACAACTGGAAGCATGCGGTCACTGTAGCACACTGCATGTATGCCATACTTCAGAACAATCACACGCT
TTTCACAGACCTTGAGCGCAAAGGACTGCTGATTGCGTGTCTGTGTCATGACCTGGACCACAGGGGCTTC
AGTAACAGCTACCTGCAGAAGTTCGACCACCCTCTGGCCGCTCTCTACTCCACTTCCACCATGGAGCAGC
ACCACTTCTCCCAGACTGTGTCCATCCTTCAGTTGGAAGGGCACAATATCTTCTCCACTCTGAGCTCCAG
TGAATATGAGCAGGTGCTTGAGATCATCCGCAAAGCCATCATTGCCACAGACCTTGCTTTATACTTTGGA
AACAGGAAGCAGTTGGAAGAGATGTACCAGACCGGATCACTAAACCTTAATAATCAATCACATAGAGACC
GTGTAATTGGTTTGATGATGACTGCCTGTGACCTTTGTTCTGTGACAAAACTGTGGCCCGTTACAAAATT
GACGGCAAATGATATATATGCAGAATTCTGGGCTGAGGGTGATGAAATGAAGAAATTGGGAATACAGCCT
ATTCCTATGATGGACAGAGACAAGAAGGATGAAGTCCCCCAAGGCCAGCTTGGGTTCTACAATGCCGTGG
CCATTCCCTGCTATACAACCCTTACCCAGATCCTCCCTCCCACGGAGCCTCTTCTGAAAGCATGCAGGGA
TAATCTCAGTCAGTGGGAGAAGGTGATTCGAGGGGAGGAGACTGCAACCTGGATTTCATCCCCATCCGTG
GCTCAGAAGGCAGCTGCATCTGAAGAT


ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT
ACAAGGATGACGACGATAAG
GTTTAA
>RC211181 representing NM_006661
Red=Cloning site Green=Tags(s)

MRIEERKSQHLTGLTDEKVKAYLSLHPQVLDEFVSESVSAETVEKWLKRKNNKSEDESAPKEVSRYQDTN
MQGVVYELNSYIEQRLDTGGDNQLLLYELSSIIKIATKADGFALYFLGECNNSLCIFTPPGIKEGKPRLI
PAGPITQGTTVSAYVAKSRKTLLVEDILGDERFPRGTGLESGTRIQSVLCLPIVTAIGDLIGILELYRHW
GKEAFCLSHQEVATANLAWASVAIHQVQVCRGLAKQTELNDFLLDVSKTYFDNIVAIDSLLEHIMIYAKN
LVNADRCALFQVDHKNKELYSDLFDIGEEKEGKPVFKKTKEIRFSIEKGIAGQVARTGEVLNIPDAYADP
RFNREVDLYTGYTTRNILCMPIVSRGSVIGVVQMVNKISGSAFSKTDENNFKMFAVFCALALHCANMYHR
IRHSECIYRVTMEKLSYHSICTSEEWQGLMQFTLPVRLCKEIELFHFDIGPFENMWPGIFVYMVHRSCGT
SCFELEKLCRFIMSVKKNYRRVPYHNWKHAVTVAHCMYAILQNNHTLFTDLERKGLLIACLCHDLDHRGF
SNSYLQKFDHPLAALYSTSTMEQHHFSQTVSILQLEGHNIFSTLSSSEYEQVLEIIRKAIIATDLALYFG
NRKQLEEMYQTGSLNLNNQSHRDRVIGLMMTACDLCSVTKLWPVTKLTANDIYAEFWAEGDEMKKLGIQP
IPMMDRDKKDEVPQGQLGFYNAVAIPCYTTLTQILPPTEPLLKACRDNLSQWEKVIRGEETATWISSPSV
AQKAAASED

myc-FLAG tag
Chromatograms CHROMATOGRAMS
Sequencher program is needed, download here.
Restriction Sites SgfI-MluI      Cloning Scheme for this gene      Plasmid Map     
ACCN NM_006661
ORF Size 2337 bp
OTI Disclaimer The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Product Components The ORF clone is ion-exchange column purified and shipped in a 2D barcoded Matrix tube containing 10ug of transfection-ready, dried plasmid DNA (reconstitute with 100 ul of water).
Reconstitution 1. Centrifuge at 5,000xg for 5min.
2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA.
3. Close the tube and incubate for 10 minutes at room temperature.
4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom.
5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C.
Reference Data
RefSeq NM_006661.4
RefSeq Size 4576 bp
RefSeq ORF 2340 bp
Locus ID 10846
UniProt ID Q9Y233
Cytogenetics 6q27
Domains PDEase, GAF
Protein Families Druggable Genome
Protein Pathways Progesterone-mediated oocyte maturation, Purine metabolism
MW 88.2 kDa
Gene Summary The protein encoded by this gene belongs to the cyclic nucleotide phosphodiesterase family. It plays a role in signal transduction by regulating the intracellular concentration of cyclic nucleotides. This protein can hydrolyze both cAMP and cGMP to the corresponding nucleoside 5' monophosphate, but has higher affinity for cAMP, and is more efficient with cAMP as substrate. Alternatively spliced transcript variants have been described for this gene. [provided by RefSeq, Dec 2011]

Other Versions

Other products for "PDE10A"
Frequently bought together (5)
Clone OTI4C5, Anti-DDK (FLAG) monoclonal antibody
    • 30 ul

USD 165.00


pCMV6-Entry, mammalian vector with C-terminal Myc- DDK Tag, 10ug
    • 10 ug

USD 627.00


DH5α Chemically Competent Cells (≥10^8 cfu/μg of pUC19 DNA)
    • 5 x 200 ul

USD 149.00


Forward sequencing primer VP1.5, Reverse sequencing primer XL39, 100pmoles each
    • 100 pmol

USD 55.00


Anti-PDE10A mouse monoclonal antibody, clone OTI1C9 (formerly 1C9)
    • 100 ul

USD 417.00

Customer Reviews 
Loading...
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.