Cyclin A2(CCNA2) (NM_001237) Human Tagged ORF Clone

CAT#: RC211148

CCNA2 (Myc-DDK-tagged)-Human cyclin A2 (CCNA2)

Need custom modification / cloning service?
Get a free quote

USD 577.00


Availability*
In Stock

Size
    • 10 ug

Cited in 1 publication.

Product images

Specifications

Product Data
Product Name Cyclin A2(CCNA2) (NM_001237) Human Tagged ORF Clone
Symbol CCNA2
Synonyms CCN1; CCNA
Vector pCMV6-Entry
Sequence Data
>RC211148 representing NM_001237
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGTTGGGCAACTCTGCGCCGGGGCCTGCGACCCGCGAGGCGGGCTCGGCGCTGCTAGCATTGCAGCAGA
CGGCGCTCCAAGAGGACCAGGAGAATATCAACCCGGAAAAGGCAGCGCCCGTCCAACAACCGCGGACCCG
GGCCGCGCTGGCGGTACTGAAGTCCGGGAACCCGCGGGGTCTAGCGCAGCAGCAGAGGCCGAAGACGAGA
CGGGTTGCACCCCTTAAGGATCTTCCTGTAAATGATGAGCATGTCACCGTTCCTCCTTGGAAAGCAAACA
GTAAACAGCCTGCGTTCACCATTCATGTGGATGAAGCAGAAAAAGAAGCTCAGAAGAAGCCAGCTGAATC
TCAAAAAATAGAGCGTGAAGATGCCCTGGCTTTTAATTCAGCCATTAGTTTACCTGGACCCAGAAAACCA
TTGGTCCCTCTTGATTATCCAATGGATGGTAGTTTTGAGTCACCACATACTATGGACATGTCAATTGTAT
TAGAAGATGAAAAGCCAGTGAGTGTTAATGAAGTACCAGACTACCATGAGGATATTCACACATACCTTAG
GGAAATGGAGGTTAAATGTAAACCTAAAGTGGGTTACATGAAGAAACAGCCAGACATCACTAACAGTATG
AGAGCTATCCTCGTGGACTGGTTAGTTGAAGTAGGAGAAGAATATAAACTACAGAATGAGACCCTGCATT
TGGCTGTGAACTACATTGATAGGTTCCTGTCTTCCATGTCAGTGCTGAGAGGAAAACTTCAGCTTGTGGG
CACTGCTGCTATGCTGTTAGCCTCAAAGTTTGAAGAAATATACCCCCCAGAAGTAGCAGAGTTTGTGTAC
ATTACAGATGATACCTACACCAAGAAACAAGTTCTGAGAATGGAGCATCTAGTTTTGAAAGTCCTTACTT
TTGACTTAGCTGCTCCAACAGTAAATCAGTTTCTTACCCAATACTTTCTGCATCAGCAGCCTGCAAACTG
CAAAGTTGAAAGTTTAGCAATGTTTTTGGGAGAATTAAGTTTGATAGATGCTGACCCATACCTCAAGTAT
TTGCCATCAGTTATTGCTGGAGCTGCCTTTCATTTAGCACTCTACACAGTCACGGGACAAAGCTGGCCTG
AATCATTAATACGAAAGACTGGATATACCCTGGAAAGTCTTAAGCCTTGTCTCATGGACCTTCACCAGAC
CTACCTCAAAGCACCACAGCATGCACAACAGTCAATAAGAGAAAAGTACAAAAATTCAAAGTATCATGGT
GTTTCTCTCCTCAACCCACCAGAGACACTAAATCTG


ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT
ACAAGGATGACGACGATAAG
GTTTAA
>RC211148 representing NM_001237
Red=Cloning site Green=Tags(s)

MLGNSAPGPATREAGSALLALQQTALQEDQENINPEKAAPVQQPRTRAALAVLKSGNPRGLAQQQRPKTR
RVAPLKDLPVNDEHVTVPPWKANSKQPAFTIHVDEAEKEAQKKPAESQKIEREDALAFNSAISLPGPRKP
LVPLDYPMDGSFESPHTMDMSIVLEDEKPVSVNEVPDYHEDIHTYLREMEVKCKPKVGYMKKQPDITNSM
RAILVDWLVEVGEEYKLQNETLHLAVNYIDRFLSSMSVLRGKLQLVGTAAMLLASKFEEIYPPEVAEFVY
ITDDTYTKKQVLRMEHLVLKVLTFDLAAPTVNQFLTQYFLHQQPANCKVESLAMFLGELSLIDADPYLKY
LPSVIAGAAFHLALYTVTGQSWPESLIRKTGYTLESLKPCLMDLHQTYLKAPQHAQQSIREKYKNSKYHG
VSLLNPPETLNL

myc-FLAG tag
Chromatograms CHROMATOGRAMS
Sequencher program is needed, download here.
Restriction Sites SgfI-MluI      Cloning Scheme for this gene      Plasmid Map     
Tag Myc-DDK
ACCN NM_001237
ORF Size 1296 bp
OTI Disclaimer The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Product Components The ORF clone is ion-exchange column purified, transfection-ready dried plasmid DNA, and shipped with 2 vector sequencing primers.
Reference Data
RefSeq NM_001237.1, NM_001237.2, NM_001237.3, NM_001237.4, NP_001228
RefSeq Size 1682
RefSeq ORF 1299
Locus ID 890
Cytogenetics 4q27
Domains cyclin_C, CYCLIN, cyclin
Protein Families Stem cell - Pluripotency, Druggable Genome
Protein Pathways Cell cycle, Progesterone-mediated oocyte maturation
MW 48.4 kDa
Gene Summary The protein encoded by this gene belongs to the highly conserved cyclin family, whose members function as regulators of the cell cycle. This protein binds and activates cyclin-dependent kinase 2 and thus promotes transition through G1/S and G2/M. [provided by RefSeq, Aug 2016].
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Citations (1)