IL12RB2 (NM_001559) Human Tagged ORF Clone

CAT#: RC211143

Reviews ()
Write a review

IL12RB2 (Myc-DDK-tagged)-Human interleukin 12 receptor, beta 2 (IL12RB2)



  "NM_001559" in other vectors (6)

Reconstitution Protocol

Special Offer: 20% off the control vector (empty cloning vector without insert). Use code "Shuttle20".

USD 477.00


Availability*
In Stock

Size
    • 10 ug


Product images

Specifications

Product Data
Type Human Tagged ORF Clone
Tag Myc-DDK
Symbol IL12RB2
Vector pCMV6-Entry
E. coli Selection Kanamycin (25 ug/mL)
Mammalian Cell Selection Neomycin
Sequence Data
>RC211143 ORF sequence
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGGCACATACTTTTAGAGGATGCTCATTGGCATTTATGTTTATAATCACGTGGCTGTTGATTAAAGCAA
AAATAGATGCGTGCAAGAGAGGCGATGTGACTGTGAAGCCTTCCCATGTAATTTTACTTGGATCCACTGT
CAATATTACATGCTCTTTGAAGCCCAGACAAGGCTGCTTTCACTATTCCAGACGTAACAAGTTAATCCTG
TACAAGTTTGACAGAAGAATCAATTTTCACCATGGCCACTCCCTCAATTCTCAAGTCACAGGTCTTCCCC
TTGGTACAACCTTGTTTGTCTGCAAACTGGCCTGTATCAATAGTGATGAAATTCAAATATGTGGAGCAGA
GATCTTCGTTGGTGTTGCTCCAGAACAGCCTCAAAATTTATCCTGCATACAGAAGGGAGAACAGGGGACT
GTGGCCTGCACCTGGGAAAGAGGACGAGACACCCACTTATACACTGAGTATACTCTACAGCTAAGTGGAC
CAAAAAATTTAACCTGGCAGAAGCAATGTAAAGACATTTATTGTGACTATTTGGACTTTGGAATCAACCT
CACCCCTGAATCACCTGAATCCAATTTCACAGCCAAGGTTACTGCTGTCAATAGTCTTGGAAGCTCCTCT
TCACTTCCATCCACATTCACATTCTTGGACATAGTGAGGCCTCTTCCTCCGTGGGACATTAGAATCAAAT
TTCAAAAGGCTTCCGTGAGCAGATGTACCCTTTATTGGAGAGATGAGGGACTGGTACTGCTTAATCGACT
CAGATATCGGCCCAGTAACAGCAGGCTCTGGAATATGGTTAATGTTACAAAGGCCAAAGGAAGACATGAT
TTGCTGGATCTGAAACCATTTACAGAATATGAATTTCAGATTTCCTCTAAGCTACATCTTTATAAGGGAA
GTTGGAGTGATTGGAGTGAATCATTGAGAGCACAAACACCAGAAGAAGAGCCTACTGGGATGTTAGATGT
CTGGTACATGAAACGGCACATTGACTACAGTAGACAACAGATTTCTCTTTTCTGGAAGAATCTGAGTGTC
TCAGAGGCAAGAGGAAAAATTCTCCACTATCAGGTGACCTTGCAGGAGCTGACAGGAGGGAAAGCCATGA
CACAGAACATCACAGGACACACCTCCTGGACCACAGTCATTCCTAGAACCGGAAATTGGGCTGTGGCTGT
GTCTGCAGCAAATTCAAAAGGCAGTTCTCTGCCCACTCGTATTAACATAATGAACCTGTGTGAGGCAGGG
TTGCTGGCTCCTCGCCACGTCTCTGCAAACTCAGAGGGCATGGACAACATTCTGGTGACTTGGCAGCCTC
CCAGGAAAGATCCCTCTGCTGTTCAGGAGTACGTGGTGGAATGGAGAGAGCTCCATCCAGGGGGTGACAC
ACAGGTCCCTCTAAACTGGCTACGGAGTCGACCCTACAATGTGTCTGCTCTGATTTCAGAGAACATAAAA
TCCTACATCTGTTATGAAATCCGTGTGTATGCACTCTCAGGGGATCAAGGAGGATGCAGCTCCATCCTGG
GTAACTCTAAGCACAAAGCACCACTGAGTGGCCCCCACATTAATGCCATCACAGAGGAAAAGGGGAGCAT
TTTAATTTCATGGAACAGCATTCCAGTCCAGGAGCAAATGGGCTGCCTCCTCCATTATAGGATATACTGG
AAGGAACGGGACTCCAACTCCCAGCCTCAGCTCTGTGAAATTCCCTACAGAGTCTCCCAAAATTCACATC
CAATAAACAGCCTGCAGCCCCGAGTGACATATGTCCTGTGGATGACAGCTCTGACAGCTGCTGGTGAAAG
TTCCCACGGAAATGAGAGGGAATTTTGTCTGCAAGGTAAAGCCAATTGGATGGCGTTTGTGGCACCAAGC
ATTTGCATTGCTATCATCATGGTGGGCATTTTCTCAACGCATTACTTCCAGCAAAAGGTGTTTGTTCTCC
TAGCAGCCCTCAGACCTCAGTGGTGTAGCAGAGAAATTCCAGATCCAGCAAATAGCACTTGCGCTAAGAA
ATATCCCATTGCAGAGGAGAAGACACAGCTGCCCTTGGACAGGCTCCTGATAGACTGGCCCACGCCTGAA
GATCCTGAACCGCTGGTCATCAGTGAAGTCCTTCATCAAGTGACCCCAGTTTTCAGACATCCCCCCTGCT
CCAACTGGCCACAAAGGGAAAAAGGAATCCAAGGTCATCAGGCCTCTGAGAAAGACATGATGCACAGTGC
CTCAAGCCCACCACCTCCAAGAGCTCTCCAAGCTGAGAGCAGACAACTGGTGGATCTGTACAAGGTGCTG
GAGAGCAGGGGCTCCGACCCAAAGCCAGAAAACCCAGCCTGTCCCTGGACGGTGCTCCCAGCAGGTGACC
TTCCCACCCATGATGGCTACTTACCCTCCAACATAGATGACCTCCCCTCACATGAGGCACCTCTCGCTGA
CTCTCTGGAAGAACTGGAGCCTCAGCACATCTCCCTTTCTGTTTTCCCCTCAAGTTCTCTTCACCCACTC
ACCTTCTCCTGTGGTGATAAGCTGACTCTGGATCAGTTAAAGATGAGGTGTGACTCCCTCATGCTC


ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT
ACAAGGATGACGACGATAAG
GTTTAA
>RC211143 protein sequence
Red=Cloning site Green=Tags(s)

MAHTFRGCSLAFMFIITWLLIKAKIDACKRGDVTVKPSHVILLGSTVNITCSLKPRQGCFHYSRRNKLIL
YKFDRRINFHHGHSLNSQVTGLPLGTTLFVCKLACINSDEIQICGAEIFVGVAPEQPQNLSCIQKGEQGT
VACTWERGRDTHLYTEYTLQLSGPKNLTWQKQCKDIYCDYLDFGINLTPESPESNFTAKVTAVNSLGSSS
SLPSTFTFLDIVRPLPPWDIRIKFQKASVSRCTLYWRDEGLVLLNRLRYRPSNSRLWNMVNVTKAKGRHD
LLDLKPFTEYEFQISSKLHLYKGSWSDWSESLRAQTPEEEPTGMLDVWYMKRHIDYSRQQISLFWKNLSV
SEARGKILHYQVTLQELTGGKAMTQNITGHTSWTTVIPRTGNWAVAVSAANSKGSSLPTRINIMNLCEAG
LLAPRHVSANSEGMDNILVTWQPPRKDPSAVQEYVVEWRELHPGGDTQVPLNWLRSRPYNVSALISENIK
SYICYEIRVYALSGDQGGCSSILGNSKHKAPLSGPHINAITEEKGSILISWNSIPVQEQMGCLLHYRIYW
KERDSNSQPQLCEIPYRVSQNSHPINSLQPRVTYVLWMTALTAAGESSHGNEREFCLQGKANWMAFVAPS
ICIAIIMVGIFSTHYFQQKVFVLLAALRPQWCSREIPDPANSTCAKKYPIAEEKTQLPLDRLLIDWPTPE
DPEPLVISEVLHQVTPVFRHPPCSNWPQREKGIQGHQASEKDMMHSASSPPPPRALQAESRQLVDLYKVL
ESRGSDPKPENPACPWTVLPAGDLPTHDGYLPSNIDDLPSHEAPLADSLEELEPQHISLSVFPSSSLHPL
TFSCGDKLTLDQLKMRCDSLML

myc-FLAG tag
Chromatograms CHROMATOGRAMS
Sequencher program is needed, download here.
Restriction Sites SgfI-MluI      Cloning Scheme for this gene      Plasmid Map     
ACCN NM_001559
ORF Size 2586 bp
OTI Disclaimer The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Product Components The ORF clone is ion-exchange column purified and shipped in a 2D barcoded Matrix tube containing 10ug of transfection-ready, dried plasmid DNA (reconstitute with 100 ul of water).
Reconstitution 1. Centrifuge at 5,000xg for 5min.
2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA.
3. Close the tube and incubate for 10 minutes at room temperature.
4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom.
5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C.
Reference Data
RefSeq NM_001559.2, NP_001550.1
RefSeq Size 4040 bp
RefSeq ORF 2589 bp
Locus ID 3595
UniProt ID Q99665
Cytogenetics 1p31.3
Domains FN3
Protein Families Druggable Genome, Transmembrane
Protein Pathways Cytokine-cytokine receptor interaction, Jak-STAT signaling pathway
MW 97.1 kDa
Gene Summary The protein encoded by this gene is a type I transmembrane protein identified as a subunit of the interleukin 12 receptor complex. The coexpression of this and IL12RB1 proteins was shown to lead to the formation of high-affinity IL12 binding sites and reconstitution of IL12 dependent signaling. The expression of this gene is up-regulated by interferon gamma in Th1 cells, and plays a role in Th1 cell differentiation. The up-regulation of this gene is found to be associated with a number of infectious diseases, such as Crohn's disease and leprosy, which is thought to contribute to the inflammatory response and host defense. Several transcript variants encoding different isoforms and non-protein coding transcripts have been found for this gene. [provided by RefSeq, Apr 2012]

Other Versions

Other products for "IL12RB2"
Frequently bought together (5)
Clone OTI4C5, Anti-DDK (FLAG) monoclonal antibody
    • 30 ul

USD 165.00


pCMV6-Entry, mammalian vector with C-terminal Myc- DDK Tag, 10ug
    • 10 ug

USD 627.00


Rabbit Polyclonal Anti-IL12RB2 Antibody
    • 100 ul

USD 380.00


DH5α Chemically Competent Cells (≥10^8 cfu/μg of pUC19 DNA)
    • 5 x 200 ul

USD 149.00


Forward sequencing primer VP1.5, Reverse sequencing primer XL39, 100pmoles each
    • 100 pmol

USD 55.00

Customer Reviews 
Loading...
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.