COMP (NM_000095) Human Tagged ORF Clone

CAT#: RC211080

Reviews ()
Write a review

COMP (Myc-DDK-tagged)-Human cartilage oligomeric matrix protein (COMP)



Reconstitution Protocol

USD 693.00

In Stock*

Size
    • 10 ug

Product images

Other products for "COMP"

Specifications

Product Data
Type Human Tagged ORF Clone
Tag Myc-DDK
Symbol COMP
Synonyms CTS2; EDM1; EPD1; MED; PSACH; THBS5; TSP5
Vector pCMV6-Entry
E. coli Selection Kanamycin (25 ug/mL)
Mammalian Cell Selection Neomycin
Sequence Data
>RC211080 ORF sequence
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGGTCCCCGACACCGCCTGCGTTCTTCTGCTCACCCTGGCTGCCCTCGGCGCGTCCGGACAGGGCCAGA
GCCCGTTGGGCTCAGACCTGGGCCCGCAGATGCTTCGGGAACTGCAGGAAACCAACGCGGCGCTGCAGGA
CGTGCGGGAGCTGCTGCGGCAGCAGGTCAGGGAGATCACGTTCCTGAAAAACACGGTGATGGAGTGTGAC
GCGTGCGGGATGCAGCAGTCAGTACGCACCGGCCTACCCAGCGTGCGGCCCCTGCTCCACTGCGCGCCCG
GCTTCTGCTTCCCCGGCGTGGCCTGCATCCAGACGGAGAGCGGCGCGCGCTGCGGCCCCTGCCCCGCGGG
CTTCACGGGCAACGGCTCGCACTGCACCGACGTCAACGAGTGCAACGCCCACCCCTGCTTCCCCCGAGTC
CGCTGTATCAACACCAGCCCGGGGTTCCGCTGCGAGGCTTGCCCGCCGGGGTACAGCGGCCCCACCCACC
AGGGCGTGGGGCTGGCTTTCGCCAAGGCCAACAAGCAGGTTTGCACGGACATCAACGAGTGTGAGACCGG
GCAACATAACTGCGTCCCCAACTCCGTGTGCATCAACACCCGGGGCTCCTTCCAGTGCGGCCCGTGCCAG
CCCGGCTTCGTGGGCGACCAGGCGTCCGGCTGCCAGCGGCGCGCACAGCGCTTCTGCCCCGACGGCTCGC
CCAGCGAGTGCCACGAGCATGCAGACTGCGTCCTAGAGCGCGATGGCTCGCGGTCGTGCGTGTGTGCCGT
TGGCTGGGCCGGCAACGGGATCCTCTGTGGTCGCGACACTGACCTAGACGGCTTCCCGGACGAGAAGCTG
CGCTGCCCGGAGCGCCAGTGCCGTAAGGACAACTGCGTGACTGTGCCCAACTCAGGGCAGGAGGATGTGG
ACCGCGATGGCATCGGAGACGCCTGCGATCCGGATGCCGACGGGGACGGGGTCCCCAATGAAAAGGACAA
CTGCCCGCTGGTGCGGAACCCAGACCAGCGCAACACGGACGAGGACAAGTGGGGCGATGCGTGCGACAAC
TGCCGGTCCCAGAAGAACGACGACCAAAAGGACACAGACCAGGACGGCCGGGGCGATGCGTGCGACGACG
ACATCGACGGCGACCGGATCCGCAACCAGGCCGACAACTGCCCTAGGGTACCCAACTCAGACCAGAAGGA
CAGTGATGGCGATGGTATAGGGGATGCCTGTGACAACTGTCCCCAGAAGAGCAACCCGGATCAGGCGGAT
GTGGACCACGACTTTGTGGGAGATGCTTGTGACAGCGATCAAGACCAGGATGGAGACGGACATCAGGACT
CTCGGGACAACTGTCCCACGGTGCCTAACAGTGCCCAGGAGGACTCAGACCACGATGGCCAGGGTGATGC
CTGCGACGACGACGACGACAATGACGGAGTCCCTGACAGTCGGGACAACTGCCGCCTGGTGCCTAACCCC
GGCCAGGAGGACGCGGACAGGGACGGCGTGGGCGACGTGTGCCAGGACGACTTTGATGCAGACAAGGTGG
TAGACAAGATCGACGTGTGTCCGGAGAACGCTGAAGTCACGCTCACCGACTTCAGGGCCTTCCAGACAGT
CGTGCTGGACCCGGAGGGTGACGCGCAGATTGACCCCAACTGGGTGGTGCTCAACCAGGGAAGGGAGATC
GTGCAGACAATGAACAGCGACCCAGGCCTGGCTGTGGGTTACACTGCCTTCAATGGCGTGGACTTCGAGG
GCACGTTCCATGTGAACACGGTCACGGATGACGACTATGCGGGCTTCATCTTTGGCTACCAGGACAGCTC
CAGCTTCTACGTGGTCATGTGGAAGCAGATGGAGCAAACGTATTGGCAGGCGAACCCCTTCCGTGCTGTG
GCCGAGCCTGGCATCCAACTCAAGGCTGTGAAGTCTTCCACAGGCCCCGGGGAACAGCTGCGGAACGCTC
TGTGGCATACAGGAGACACAGAGTCCCAGGTGCGGCTGCTGTGGAAGGACCCGCGAAACGTGGGTTGGAA
GGACAAGAAGTCCTATCGTTGGTTCCTGCAGCACCGGCCCCAAGTGGGCTACATCAGGGTGCGATTCTAT
GAGGGCCCTGAGCTGGTGGCCGACAGCAACGTGGTCTTGGACACAACCATGCGGGGTGGCCGCCTGGGGG
TCTTCTGCTTCTCCCAGGAGAACATCATCTGGGCCAACCTGCGTTACCGCTGCAATGACACCATCCCAGA
GGACTATGAGACCCATCAGCTGCGGCAAGCC


AGCGGACCGACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCC
TGGATTACAAGGATGACGACGATAAG
GTTTAA
>RC211080 protein sequence
Red=Cloning site Green=Tags(s)

MVPDTACVLLLTLAALGASGQGQSPLGSDLGPQMLRELQETNAALQDVRELLRQQVREITFLKNTVMECD
ACGMQQSVRTGLPSVRPLLHCAPGFCFPGVACIQTESGARCGPCPAGFTGNGSHCTDVNECNAHPCFPRV
RCINTSPGFRCEACPPGYSGPTHQGVGLAFAKANKQVCTDINECETGQHNCVPNSVCINTRGSFQCGPCQ
PGFVGDQASGCQRRAQRFCPDGSPSECHEHADCVLERDGSRSCVCAVGWAGNGILCGRDTDLDGFPDEKL
RCPERQCRKDNCVTVPNSGQEDVDRDGIGDACDPDADGDGVPNEKDNCPLVRNPDQRNTDEDKWGDACDN
CRSQKNDDQKDTDQDGRGDACDDDIDGDRIRNQADNCPRVPNSDQKDSDGDGIGDACDNCPQKSNPDQAD
VDHDFVGDACDSDQDQDGDGHQDSRDNCPTVPNSAQEDSDHDGQGDACDDDDDNDGVPDSRDNCRLVPNP
GQEDADRDGVGDVCQDDFDADKVVDKIDVCPENAEVTLTDFRAFQTVVLDPEGDAQIDPNWVVLNQGREI
VQTMNSDPGLAVGYTAFNGVDFEGTFHVNTVTDDDYAGFIFGYQDSSSFYVVMWKQMEQTYWQANPFRAV
AEPGIQLKAVKSSTGPGEQLRNALWHTGDTESQVRLLWKDPRNVGWKDKKSYRWFLQHRPQVGYIRVRFY
EGPELVADSNVVLDTTMRGGRLGVFCFSQENIIWANLRYRCNDTIPEDYETHQLRQA

SGPTRTRPLEQKLISEEDLAANDILDYKDDDDKV
Chromatograms CHROMATOGRAMS
Sequencher program is needed, download here.
Restriction Sites SgfI-RsrII      Cloning Scheme for this gene      Plasmid Map     
ACCN NM_000095
ORF Size 2271 bp
OTI Disclaimer The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Product Components The ORF clone is ion-exchange column purified and shipped in a 2D barcoded Matrix tube containing 10ug of transfection-ready, dried plasmid DNA (reconstitute with 100 ul of water).
Reconstitution 1. Centrifuge at 5,000xg for 5min.
2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA.
3. Close the tube and incubate for 10 minutes at room temperature.
4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom.
5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C.
Reference Data
RefSeq NM_000095.3
RefSeq Size 2471 bp
RefSeq ORF 2274 bp
Locus ID 1311
UniProt ID P49747
Cytogenetics 19p13.11
Domains EGF_CA, tsp_3, EGF, EGF
Protein Families Druggable Genome, Secreted Protein
Protein Pathways ECM-receptor interaction, Focal adhesion, TGF-beta signaling pathway
MW 82.9 kDa
Gene Summary The protein encoded by this gene is a noncollagenous extracellular matrix (ECM) protein. It consists of five identical glycoprotein subunits, each with EGF-like and calcium-binding (thrombospondin-like) domains. Oligomerization results from formation of a five-stranded coiled coil and disulfides. Binding to other ECM proteins such as collagen appears to depend on divalent cations. Contraction or expansion of a 5 aa aspartate repeat and other mutations can cause pseudochondroplasia (PSACH) and multiple epiphyseal dysplasia (MED). [provided by RefSeq, Jul 2016]
Customer Reviews 
Loading...
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.