COMP (NM_000095) Human Tagged ORF Clone

CAT#: RC211080

COMP (Myc-DDK-tagged)-Human cartilage oligomeric matrix protein (COMP)

Need custom modification / cloning service?
Get a free quote

USD 577.00


Availability*
In Stock

Size
    • 10 ug

Cited in 1 publication.

Product images

Specifications

Product Data
Product Name COMP (NM_000095) Human Tagged ORF Clone
Symbol COMP
Synonyms EDM1; EPD1; MED; PSACH; THBS5
Vector pCMV6-Entry
Sequence Data
>RC211080 representing NM_000095
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGGTCCCCGACACCGCCTGCGTTCTTCTGCTCACCCTGGCTGCCCTCGGCGCGTCCGGACAGGGCCAGA
GCCCGTTGGGCTCAGACCTGGGCCCGCAGATGCTTCGGGAACTGCAGGAAACCAACGCGGCGCTGCAGGA
CGTGCGGGAGCTGCTGCGGCAGCAGGTCAGGGAGATCACGTTCCTGAAAAACACGGTGATGGAGTGTGAC
GCGTGCGGGATGCAGCAGTCAGTACGCACCGGCCTACCCAGCGTGCGGCCCCTGCTCCACTGCGCGCCCG
GCTTCTGCTTCCCCGGCGTGGCCTGCATCCAGACGGAGAGCGGCGCGCGCTGCGGCCCCTGCCCCGCGGG
CTTCACGGGCAACGGCTCGCACTGCACCGACGTCAACGAGTGCAACGCCCACCCCTGCTTCCCCCGAGTC
CGCTGTATCAACACCAGCCCGGGGTTCCGCTGCGAGGCTTGCCCGCCGGGGTACAGCGGCCCCACCCACC
AGGGCGTGGGGCTGGCTTTCGCCAAGGCCAACAAGCAGGTTTGCACGGACATCAACGAGTGTGAGACCGG
GCAACATAACTGCGTCCCCAACTCCGTGTGCATCAACACCCGGGGCTCCTTCCAGTGCGGCCCGTGCCAG
CCCGGCTTCGTGGGCGACCAGGCGTCCGGCTGCCAGCGGCGCGCACAGCGCTTCTGCCCCGACGGCTCGC
CCAGCGAGTGCCACGAGCATGCAGACTGCGTCCTAGAGCGCGATGGCTCGCGGTCGTGCGTGTGTGCCGT
TGGCTGGGCCGGCAACGGGATCCTCTGTGGTCGCGACACTGACCTAGACGGCTTCCCGGACGAGAAGCTG
CGCTGCCCGGAGCGCCAGTGCCGTAAGGACAACTGCGTGACTGTGCCCAACTCAGGGCAGGAGGATGTGG
ACCGCGATGGCATCGGAGACGCCTGCGATCCGGATGCCGACGGGGACGGGGTCCCCAATGAAAAGGACAA
CTGCCCGCTGGTGCGGAACCCAGACCAGCGCAACACGGACGAGGACAAGTGGGGCGATGCGTGCGACAAC
TGCCGGTCCCAGAAGAACGACGACCAAAAGGACACAGACCAGGACGGCCGGGGCGATGCGTGCGACGACG
ACATCGACGGCGACCGGATCCGCAACCAGGCCGACAACTGCCCTAGGGTACCCAACTCAGACCAGAAGGA
CAGTGATGGCGATGGTATAGGGGATGCCTGTGACAACTGTCCCCAGAAGAGCAACCCGGATCAGGCGGAT
GTGGACCACGACTTTGTGGGAGATGCTTGTGACAGCGATCAAGACCAGGATGGAGACGGACATCAGGACT
CTCGGGACAACTGTCCCACGGTGCCTAACAGTGCCCAGGAGGACTCAGACCACGATGGCCAGGGTGATGC
CTGCGACGACGACGACGACAATGACGGAGTCCCTGACAGTCGGGACAACTGCCGCCTGGTGCCTAACCCC
GGCCAGGAGGACGCGGACAGGGACGGCGTGGGCGACGTGTGCCAGGACGACTTTGATGCAGACAAGGTGG
TAGACAAGATCGACGTGTGTCCGGAGAACGCTGAAGTCACGCTCACCGACTTCAGGGCCTTCCAGACAGT
CGTGCTGGACCCGGAGGGTGACGCGCAGATTGACCCCAACTGGGTGGTGCTCAACCAGGGAAGGGAGATC
GTGCAGACAATGAACAGCGACCCAGGCCTGGCTGTGGGTTACACTGCCTTCAATGGCGTGGACTTCGAGG
GCACGTTCCATGTGAACACGGTCACGGATGACGACTATGCGGGCTTCATCTTTGGCTACCAGGACAGCTC
CAGCTTCTACGTGGTCATGTGGAAGCAGATGGAGCAAACGTATTGGCAGGCGAACCCCTTCCGTGCTGTG
GCCGAGCCTGGCATCCAACTCAAGGCTGTGAAGTCTTCCACAGGCCCCGGGGAACAGCTGCGGAACGCTC
TGTGGCATACAGGAGACACAGAGTCCCAGGTGCGGCTGCTGTGGAAGGACCCGCGAAACGTGGGTTGGAA
GGACAAGAAGTCCTATCGTTGGTTCCTGCAGCACCGGCCCCAAGTGGGCTACATCAGGGTGCGATTCTAT
GAGGGCCCTGAGCTGGTGGCCGACAGCAACGTGGTCTTGGACACAACCATGCGGGGTGGCCGCCTGGGGG
TCTTCTGCTTCTCCCAGGAGAACATCATCTGGGCCAACCTGCGTTACCGCTGCAATGACACCATCCCAGA
GGACTATGAGACCCATCAGCTGCGGCAAGCC


AGCGGACCGACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCC
TGGATTACAAGGATGACGACGATAAG
GTTTAA
>RC211080 representing NM_000095
Red=Cloning site Green=Tags(s)

MVPDTACVLLLTLAALGASGQGQSPLGSDLGPQMLRELQETNAALQDVRELLRQQVREITFLKNTVMECD
ACGMQQSVRTGLPSVRPLLHCAPGFCFPGVACIQTESGARCGPCPAGFTGNGSHCTDVNECNAHPCFPRV
RCINTSPGFRCEACPPGYSGPTHQGVGLAFAKANKQVCTDINECETGQHNCVPNSVCINTRGSFQCGPCQ
PGFVGDQASGCQRRAQRFCPDGSPSECHEHADCVLERDGSRSCVCAVGWAGNGILCGRDTDLDGFPDEKL
RCPERQCRKDNCVTVPNSGQEDVDRDGIGDACDPDADGDGVPNEKDNCPLVRNPDQRNTDEDKWGDACDN
CRSQKNDDQKDTDQDGRGDACDDDIDGDRIRNQADNCPRVPNSDQKDSDGDGIGDACDNCPQKSNPDQAD
VDHDFVGDACDSDQDQDGDGHQDSRDNCPTVPNSAQEDSDHDGQGDACDDDDDNDGVPDSRDNCRLVPNP
GQEDADRDGVGDVCQDDFDADKVVDKIDVCPENAEVTLTDFRAFQTVVLDPEGDAQIDPNWVVLNQGREI
VQTMNSDPGLAVGYTAFNGVDFEGTFHVNTVTDDDYAGFIFGYQDSSSFYVVMWKQMEQTYWQANPFRAV
AEPGIQLKAVKSSTGPGEQLRNALWHTGDTESQVRLLWKDPRNVGWKDKKSYRWFLQHRPQVGYIRVRFY
EGPELVADSNVVLDTTMRGGRLGVFCFSQENIIWANLRYRCNDTIPEDYETHQLRQA

SGPTRTRRLEQKLISEEDLAANDILDYKDDDDKV
Chromatograms CHROMATOGRAMS
Sequencher program is needed, download here.
Restriction Sites SgfI-RsrII      Cloning Scheme for this gene      Plasmid Map     
Tag Myc-DDK
ACCN NM_000095
ORF Size 2271 bp
OTI Disclaimer The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Product Components The ORF clone is ion-exchange column purified, transfection-ready dried plasmid DNA, and shipped with 2 vector sequencing primers.
Reference Data
RefSeq NM_000095.1, NM_000095.2, NP_000086
RefSeq Size 2471
RefSeq ORF 2274
Locus ID 1311
Cytogenetics 19p13.11
Domains EGF_CA, tsp_3, EGF, EGF
Protein Families Secreted Protein, Druggable Genome
Protein Pathways TGF-beta signaling pathway, Focal adhesion, ECM-receptor interaction
MW 82.86 kDa
Gene Summary The protein encoded by this gene is a noncollagenous extracellular matrix (ECM) protein. It consists of five identical glycoprotein subunits, each with EGF-like and calcium-binding (thrombospondin-like) domains. Oligomerization results from formation of a five-stranded coiled coil and disulfides. Binding to other ECM proteins such as collagen appears to depend on divalent cations. Contraction or expansion of a 5 aa aspartate repeat and other mutations can cause pseudochondroplasia (PSACH) and multiple epiphyseal dysplasia (MED). [provided by RefSeq, Jul 2016]
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Citations (1)