C1orf31(COA6) (NM_001012985) Human Tagged ORF Clone

CAT#: RC211054

COA6 (Myc-DDK-tagged)-Human chromosome 1 open reading frame 31 (C1orf31), transcript variant 1

Change vector?

USD 98

USD 390


Availability*
In Stock

Size
    • 10 ug

Product images

Specifications

Product Data
Product Name C1orf31(COA6) (NM_001012985) Human Tagged ORF Clone
Symbol COA6
Synonyms C1orf31; CEMCOX4
Vector pCMV6-Entry
Sequence Data
ORF Nucleotide Sequence
>RC211054 representing NM_001012985
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGGGCCCGGGAGGTCCCTTACTGTCCCCGAGCCGCGGGTTCCTCTTGTGCAAAACGGGGTGGCACTCCA
ATCGCCTGCTTGGTGATTGTGGCCCCCACACACCTGTTTCTACAGCGCTTAGCTTCATCGCAGTAGGAAT
GGCAGCCCCATCTATGAAGGAAAGACAGGTCTGCTGGGGGGCCCGGGATGAGTACTGGAAGTGTTTAGAT
GAGAACTTAGAGGATGCTTCTCAATGCAAGAAGTTAAGAAGCTCTTTCGAATCAAGTTGTCCCCAACAGT
GGATAAAATATTTTGATAAAAGAAGAGACTACTTAAAATTCAAAGAAAAATTTGAAGCAGGACAATTTGA
GCCTTCAGAAACAACTGCAAAATCC


ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT
ACAAGGATGACGACGATAAG
GTTTAA
Protein Sequence
>RC211054 representing NM_001012985
Red=Cloning site Green=Tags(s)

MGPGGPLLSPSRGFLLCKTGWHSNRLLGDCGPHTPVSTALSFIAVGMAAPSMKERQVCWGARDEYWKCLD
ENLEDASQCKKLRSSFESSCPQQWIKYFDKRRDYLKFKEKFEAGQFEPSETTAKS

myc-FLAG tag
Chromatograms CHROMATOGRAMS
Sequencher program is needed, download here.
Restriction Sites SgfI-MluI      Cloning Scheme for this gene      Plasmid Map     
Tag Myc-DDK
ACCN NM_001012985
ORF Size 375 bp
OTI Disclaimer The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Product Components The ORF clone is ion-exchange column purified, transfection-ready dried plasmid DNA, and shipped with 2 vector sequencing primers.
Reference Data
RefSeq NM_001012985.1, NM_001012985.2, NP_001013003
RefSeq Size 641
RefSeq ORF 378
Locus ID 388753
Cytogenetics 1q42.2
MW 13.9 kDa
Gene Summary This gene encodes a member of the cytochrome c oxidase subunit 6B family. The encoded protein associates with cytochrome c oxidase may act has an cytochrome c oxidase mitochondrial respiratory complex VI assembly factor. Mutations in this gene may be associated with fatal infantile cardiomyopathy. Alternate splicing results in multiple transcript variants. [provided by RefSeq, Sep 2014].
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Citations