Semaphorin 7a (SEMA7A) (NM_003612) Human Tagged ORF Clone

CAT#: RC210966

Reviews ()
Write a review

SEMA7A (Myc-DDK-tagged)-Human semaphorin 7A, GPI membrane anchor (John Milton Hagen blood group) (SEMA7A), transcript variant 1



  "NM_003612" in other vectors (6)

Reconstitution Protocol

USD 620.00

In Stock*

Size
    • 10 ug

Product images

Frequently bought together (4)
Clone OTI4C5, Anti-DDK (FLAG) monoclonal antibody
    • 30 ul

USD 177.00


pCMV6-Entry, mammalian vector with C-terminal Myc- DDK Tag, 10ug
    • 10 ug

USD 650.00


DH5α Chemically Competent Cells (≥10^8 cfu/μg of pUC19 DNA)
    • 5 x 200 ul

USD 160.00


Forward sequencing primer VP1.5, Reverse sequencing primer XL39, 100pmoles each
    • 100 pmol

USD 59.00

Other products for "SEMA7A"

Specifications

Product Data
Type Human Tagged ORF Clone
Tag Myc-DDK
Symbol SEMA7A
Synonyms CD108; CDw108; H-SEMA-K1; H-Sema-L; JMH; SEMAK1; SEMAL
Vector pCMV6-Entry
E. coli Selection Kanamycin (25 ug/mL)
Mammalian Cell Selection Neomycin
Sequence Data
>RC210966 ORF sequence
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGACGCCTCCTCCGCCCGGACGTGCCGCCCCCAGCGCACCGCGCGCCCGCGTCCCTGGCCCGCCGGCTC
GGTTGGGGCTTCCGCTGCGGCTGCGGCTGCTGCTGCTGCTCTGGGCGGCCGCCGCCTCCGCCCAGGGCCA
CCTAAGGAGCGGACCCCGCATCTTCGCCGTCTGGAAAGGCCATGTAGGGCAGGACCGGGTGGACTTTGGC
CAGACTGAGCCGCACACGGTGCTTTTCCACGAGCCAGGCAGCTCCTCTGTGTGGGTGGGAGGACGTGGCA
AGGTCTACCTCTTTGACTTCCCCGAGGGCAAGAACGCATCTGTGCGCACGGTGAATATCGGCTCCACAAA
GGGGTCCTGTCTGGATAAGCGGGACTGCGAGAACTACATCACTCTCCTGGAGAGGCGGAGTGAGGGGCTG
CTGGCCTGTGGCACCAACGCCCGGCACCCCAGCTGCTGGAACCTGGTGAATGGCACTGTGGTGCCACTTG
GCGAGATGAGAGGCTACGCCCCCTTCAGCCCGGACGAGAACTCCCTGGTTCTGTTTGAAGGGGACGAGGT
GTATTCCACCATCCGGAAGCAGGAATACAATGGGAAGATCCCTCGGTTCCGCCGCATCCGGGGCGAGAGT
GAGCTGTACACCAGTGATACTGTCATGCAGAACCCACAGTTCATCAAAGCCACCATCGTGCACCAAGACC
AGGCTTACGATGACAAGATCTACTACTTCTTCCGAGAGGACAATCCTGACAAGAATCCTGAGGCTCCTCT
CAATGTGTCCCGTGTGGCCCAGTTGTGCAGGGGGGACCAGGGTGGGGAAAGTTCACTGTCAGTCTCCAAG
TGGAACACTTTTCTGAAAGCCATGCTGGTATGCAGTGATGCTGCCACCAACAAGAACTTCAACAGGCTGC
AAGACGTCTTCCTGCTCCCTGACCCCAGCGGCCAGTGGAGGGACACCAGGGTCTATGGTGTTTTCTCCAA
CCCCTGGAACTACTCAGCCGTCTGTGTGTATTCCCTCGGTGACATTGACAAGGTCTTCCGTACCTCCTCA
CTCAAGGGCTACCACTCAAGCCTTCCCAACCCGCGGCCTGGCAAGTGCCTCCCAGACCAGCAGCCGATAC
CCACAGAGACCTTCCAGGTGGCTGACCGTCACCCAGAGGTGGCGCAGAGGGTGGAGCCCATGGGGCCTCT
GAAGACGCCATTGTTCCACTCTAAATACCACTACCAGAAAGTGGCCGTCCACCGCATGCAAGCCAGCCAC
GGGGAGACCTTTCATGTGCTTTACCTAACTACAGACAGGGGCACTATCCACAAGGTGGTGGAACCGGGGG
AGCAGGAGCACAGCTTCGCCTTCAACATCATGGAGATCCAGCCCTTCCGCCGCGCGGCTGCCATCCAGAC
CATGTCGCTGGATGCTGAGCGGAGGAAGCTGTATGTGAGCTCCCAGTGGGAGGTGAGCCAGGTGCCCCTG
GACCTGTGTGAGGTCTATGGCGGGGGCTGCCACGGTTGCCTCATGTCCCGAGACCCCTACTGCGGCTGGG
ACCAAGGCCGCTGCATCTCCATCTACAGCTCCGAACGGTCAGTGCTGCAATCCATTAATCCAGCCGAGCC
ACACAAGGAGTGTCCCAACCCCAAACCAGACAAGGCCCCACTGCAGAAGGTTTCCCTGGCCCCAAACTCT
CGCTACTACCTGAGCTGCCCCATGGAATCCCGCCACGCCACCTACTCATGGCGCCACAAGGAGAACGTGG
AGCAGAGCTGCGAACCTGGTCACCAGAGCCCCAACTGCATCCTGTTCATCGAGAACCTCACGGCGCAGCA
GTACGGCCACTACTTCTGCGAGGCCCAGGAGGGCTCCTACTTCCGCGAGGCTCAGCACTGGCAGCTGCTG
CCCGAGGACGGCATCATGGCCGAGCACCTGCTGGGTCATGCCTGTGCCCTGGCCGCCTCCCTCTGGCTGG
GGGTGCTGCCCACACTCACTCTTGGCTTGCTGGTCCAC


ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT
ACAAGGATGACGACGATAAG
GTTTAA
>RC210966 protein sequence
Red=Cloning site Green=Tags(s)

MTPPPPGRAAPSAPRARVPGPPARLGLPLRLRLLLLLWAAAASAQGHLRSGPRIFAVWKGHVGQDRVDFG
QTEPHTVLFHEPGSSSVWVGGRGKVYLFDFPEGKNASVRTVNIGSTKGSCLDKRDCENYITLLERRSEGL
LACGTNARHPSCWNLVNGTVVPLGEMRGYAPFSPDENSLVLFEGDEVYSTIRKQEYNGKIPRFRRIRGES
ELYTSDTVMQNPQFIKATIVHQDQAYDDKIYYFFREDNPDKNPEAPLNVSRVAQLCRGDQGGESSLSVSK
WNTFLKAMLVCSDAATNKNFNRLQDVFLLPDPSGQWRDTRVYGVFSNPWNYSAVCVYSLGDIDKVFRTSS
LKGYHSSLPNPRPGKCLPDQQPIPTETFQVADRHPEVAQRVEPMGPLKTPLFHSKYHYQKVAVHRMQASH
GETFHVLYLTTDRGTIHKVVEPGEQEHSFAFNIMEIQPFRRAAAIQTMSLDAERRKLYVSSQWEVSQVPL
DLCEVYGGGCHGCLMSRDPYCGWDQGRCISIYSSERSVLQSINPAEPHKECPNPKPDKAPLQKVSLAPNS
RYYLSCPMESRHATYSWRHKENVEQSCEPGHQSPNCILFIENLTAQQYGHYFCEAQEGSYFREAQHWQLL
PEDGIMAEHLLGHACALAASLWLGVLPTLTLGLLVH

myc-FLAG tag
Chromatograms CHROMATOGRAMS
Sequencher program is needed, download here.
Restriction Sites SgfI-MluI      Cloning Scheme for this gene      Plasmid Map     
ACCN NM_003612
ORF Size 1998 bp
OTI Disclaimer The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Product Components The ORF clone is ion-exchange column purified and shipped in a 2D barcoded Matrix tube containing 10ug of transfection-ready, dried plasmid DNA (reconstitute with 100 ul of water).
Reconstitution 1. Centrifuge at 5,000xg for 5min.
2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA.
3. Close the tube and incubate for 10 minutes at room temperature.
4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom.
5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C.
Reference Data
RefSeq NM_003612.5
RefSeq Size 3393 bp
RefSeq ORF 2001 bp
Locus ID 8482
UniProt ID O75326
Cytogenetics 15q24.1
Domains Sema, PSI
Protein Pathways Axon guidance
MW 74.8 kDa
Gene Summary This gene encodes a member of the semaphorin family of proteins. The encoded preproprotein is proteolytically processed to generate the mature glycosylphosphatidylinositol (GPI)-anchored membrane glycoprotein. The encoded protein is found on activated lymphocytes and erythrocytes and may be involved in immunomodulatory and neuronal processes. The encoded protein carries the John Milton Hagen (JMH) blood group antigens. Mutations in this gene may be associated with reduced bone mineral density (BMD). Alternative splicing results in multiple transcript variants, at least one of which encodes an isoform that is proteolytically processed. [provided by RefSeq, Feb 2016]

Other Versions

Customer Reviews 
Loading...
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.