Axin 2 (AXIN2) (NM_004655) Human Tagged ORF Clone

USD 750.00


Availability*
In Stock

Size
    • 10 ug


Product images

Specifications

Product Data
Product Name Axin 2 (AXIN2) (NM_004655) Human Tagged ORF Clone
Type Human Tagged ORF Clone
Tag Myc-DDK
Symbol AXIN2
Synonyms AXIL; ODCRCS
Vector pCMV6-Entry
E. coli Selection Kanamycin (25 ug/mL)
Cell Selection Neomycin
Sequence Data
>RC210931 ORF sequence
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGAGTAGCGCTATGTTGGTGACTTGCCTCCCGGACCCCAGCAGCAGCTTCCGTGAGGATGCCCCGCGGC
CCCCAGTGCCAGGGGAAGAAGGGGAGACCCCACCGTGTCAGCCAGGGGTGGGCAAGGGCCAGGTCACCAA
ACCCATGTCTGTCTCTTCCAACACCAGGCGGAACGAAGATGGGTTGGGGGAGCCGGAGGGGCGGGCATCT
CCGGATTCCCCTCTGACCCGGTGGACCAAGTCCTTACACTCCTTATTGGGCGATCAAGACGGTGCTTACC
TGTTCCGAACTTTCCTGGAGAGGGAGAAATGCGTGGATACCTTAGACTTCTGGTTTGCCTGCAATGGATT
CAGGCAGATGAACCTGAAGGATACCAAAACTTTACGAGTAGCCAAAGCGATCTACAAAAGGTACATTGAG
AACAACAGCATTGTCTCCAAGCAGCTGAAGCCTGCCACCAAGACCTACATAAGAGATGGCATCAAGAAGC
AGCAGATTGATTCCATCATGTTTGACCAGGCGCAGACCGAGATCCAGTCGGTGATGGAGGAAAATGCCTA
CCAGATGTTTTTGACTTCTGATATATACCTCGAATATGTGAGGAGTGGGGGAGAAAACACAGCTTACATG
AGTAATGGGGGACTCGGGAGCCTAAAGGTCGTGTGTGGCTATCTCCCCACCTTGAATGAAGAAGAGGAGT
GGACTTGTGCCGACTTCAAGTGCAAACTTTCGCCAACCGTGGTTGGCTTGTCCAGCAAAACTCTGAGGGC
CACGGCGAGTGTGAGGTCCACGGAAACTGTTGACAGTGGATACAGGTCCTTCAAGAGGAGCGATCCTGTT
AATCCTTATCACATAGGTTCTGGCTATGTCTTTGCACCAGCCACCAGCGCCAACGACAGTGAGATATCCA
GTGATGCGCTGACGGATGATTCCATGTCCATGACGGACAGCAGTGTAGATGGAATTCCTCCTTATCGTGT
GGGCAGTAAGAAACAGCTCCAGAGAGAAATGCATCGCAGTGTGAAGGCCAATGGCCAAGTGTCTCTACCT
CATTTCCCGAGAACCCACCGCCTGCCCAAGGAGATGACCCCCGTGGAACCCGCCACCTTTGCAGCTGAGC
TGATCTCGAGGCTGGAAAAGCTGAAGCTGGAGTTGGAGAGCCGCCACAGCCTGGAGGAGCGCCTGCAGCA
GATCCGAGAGGATGAAGAGAGAGAGGGCTCCGAGCTCACACTCAATTCGCGGGAGGGGGCGCCCACGCAG
CACCCCCTCTCCCTACTGCCCTCCGGCAGCTACGAGGAAGACCCGCAGACGATACTGGACGATCACCTGT
CCAGGGTCCTCAAGACCCCTGGCTGCCAGTCTCCGGGCGTAGGCCGCTATAGCCCTCGCTCCCGCTCCCC
GGACCACCACCACCACCACCATTCGCAGTACCACTCCCTGCTCCCGCCCGGTGGCAAGCTGCCTCCCGCG
GCCGCCTCGCCGGGCGCCTGCCCCCTCCTCGGGGGCAAAGGCTTTGTGACCAAGCAGACGACGAAGCATG
TCCACCACCACTACATCCACCACCATGCCGTCCCCAAGACCAAGGAGGAGATCGAGGCGGAGGCCACGCA
GCGGGTGCACTGCTTCTGCCCTGGGGGCAGCGAGTATTACTGCTACTCGAAATGCAAAAGCCACTCCAAG
GCTCCGGAAACCATGCCCAGCGAGCAGTTTGGCGGCAGCAGAGGCAGTACCTTGCCCAAACGCAATGGGA
AAGGCACGGAGCCGGGCCTGGCCCTGCCCGCCAGGGAAGGAGGGGCCCCCGGCGGAGCTGGGGCCCTGCA
GCTTCCCCGGGAGGAAGGAGACAGGTCGCAGGATGTCTGGCAGTGGATGCTGGAGAGTGAGCGGCAGAGC
AAGCCCAAGCCCCATAGTGCCCAAAGCACAAAAAAGGCCTACCCCTTGGAGTCTGCCCGCTCGTCTCCAG
GCGAACGAGCCAGCCGGCACCATCTGTGGGGGGGCAACAGCGGGCACCCCCGCACCACCCCCCGTGCCCA
CCTGTTCACCCAGGACCCTGCGATGCCTCCCCTGACCCCACCCAACACGCTGGCTCAGCTGGAGGAGGCC
TGTCGCAGGCTAGCTGAGGTGTCGAAGCCCCCAAAGCAGCGGTGCTGTGTGGCCAGTCAGCAGAGGGACA
GGAATCATTCGGCCACTGTTCAGACGGGAGCCACACCCTTCTCCAATCCAAGCCTGGCTCCAGAAGATCA
CAAAGAGCCAAAGAAACTGGCAGGTGTCCACGCGCTCCAGGCCAGTGAGTTGGTTGTCACTTACTTTTTC
TGTGGGGAAGAAATTCCATACCGGAGGATGCTGAAGGCTCAGAGCTTGACCCTGGGCCACTTTAAAGAGC
AGCTCAGCAAAAAGGGAAATTATAGGTATTACTTCAAAAAAGCAAGCGATGAGTTTGCCTGTGGAGCGGT
GTTTGAGGAGATCTGGGAGGATGAGACGGTGCTCCCGATGTATGAAGGCCGGATTCTGGGCAAAGTGGAG
CGGATCGAT


ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT
ACAAGGATGACGACGATAAG
GTTTAA
>RC210931 protein sequence
Red=Cloning site Green=Tags(s)

MSSAMLVTCLPDPSSSFREDAPRPPVPGEEGETPPCQPGVGKGQVTKPMSVSSNTRRNEDGLGEPEGRAS
PDSPLTRWTKSLHSLLGDQDGAYLFRTFLEREKCVDTLDFWFACNGFRQMNLKDTKTLRVAKAIYKRYIE
NNSIVSKQLKPATKTYIRDGIKKQQIDSIMFDQAQTEIQSVMEENAYQMFLTSDIYLEYVRSGGENTAYM
SNGGLGSLKVVCGYLPTLNEEEEWTCADFKCKLSPTVVGLSSKTLRATASVRSTETVDSGYRSFKRSDPV
NPYHIGSGYVFAPATSANDSEISSDALTDDSMSMTDSSVDGIPPYRVGSKKQLQREMHRSVKANGQVSLP
HFPRTHRLPKEMTPVEPATFAAELISRLEKLKLELESRHSLEERLQQIREDEEREGSELTLNSREGAPTQ
HPLSLLPSGSYEEDPQTILDDHLSRVLKTPGCQSPGVGRYSPRSRSPDHHHHHHSQYHSLLPPGGKLPPA
AASPGACPLLGGKGFVTKQTTKHVHHHYIHHHAVPKTKEEIEAEATQRVHCFCPGGSEYYCYSKCKSHSK
APETMPSEQFGGSRGSTLPKRNGKGTEPGLALPAREGGAPGGAGALQLPREEGDRSQDVWQWMLESERQS
KPKPHSAQSTKKAYPLESARSSPGERASRHHLWGGNSGHPRTTPRAHLFTQDPAMPPLTPPNTLAQLEEA
CRRLAEVSKPPKQRCCVASQQRDRNHSATVQTGATPFSNPSLAPEDHKEPKKLAGVHALQASELVVTYFF
CGEEIPYRRMLKAQSLTLGHFKEQLSKKGNYRYYFKKASDEFACGAVFEEIWEDETVLPMYEGRILGKVE
RID

myc-FLAG tag
Chromatograms CHROMATOGRAMS
Sequencher program is needed, download here.
Restriction Sites SgfI-MluI      Cloning Scheme for this gene      Plasmid Map     
Tag Myc-DDK
ACCN NM_004655
ORF Size 2529 bp
OTI Disclaimer The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Product Components The ORF clone is ion-exchange column purified, transfection-ready dried plasmid DNA, and shipped with 2 vector sequencing primers.
Reconstitution 1. Centrifuge at 5,000xg for 5min.
2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA.
3. Close the tube and incubate for 10 minutes at room temperature.
4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom.
5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C.
Reference Data
RefSeq NM_004655.1, NM_004655.2, NM_004655.3, NP_004646.2
RefSeq Size 4241 bp
RefSeq ORF 2532 bp
Locus ID 8313
Cytogenetics 17q24.1
Domains RGS, DAX
Protein Families Druggable Genome, ES Cell Differentiation/IPS, Induced pluripotent stem cells
Protein Pathways Basal cell carcinoma, Colorectal cancer, Endometrial cancer, Pathways in cancer, Wnt signaling pathway
MW 93.6 kDa
Gene Summary The Axin-related protein, Axin2, presumably plays an important role in the regulation of the stability of beta-catenin in the Wnt signaling pathway, like its rodent homologs, mouse conductin/rat axil. In mouse, conductin organizes a multiprotein complex of APC (adenomatous polyposis of the colon), beta-catenin, glycogen synthase kinase 3-beta, and conductin, which leads to the degradation of beta-catenin. Apparently, the deregulation of beta-catenin is an important event in the genesis of a number of malignancies. The AXIN2 gene has been mapped to 17q23-q24, a region that shows frequent loss of heterozygosity in breast cancer, neuroblastoma, and other tumors. Mutations in this gene have been associated with colorectal cancer with defective mismatch repair. [provided by RefSeq, Jul 2008]

Citations (2)

Other Versions

Other products for "AXIN2"
Frequently bought together (3)
Clone OTI4C5, Anti-DDK (FLAG) monoclonal antibody
    • 100 ul

USD 310.00


pCMV6-Entry, mammalian vector with C-terminal Myc- DDK Tag, 10ug
    • 10 ug

USD 570.00


Rabbit anti-AXIN2 Polyclonal Antibody
    • 100 ul

USD 345.00

Customer Reviews 
Loading...
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.
68 Mouse Clones
Molbio tools