GPR10 (PRLHR) (NM_004248) Human Tagged ORF Clone

CAT#: RC210917

Reviews ()
Write a review

PRLHR (Myc-DDK-tagged)-Human prolactin releasing hormone receptor (PRLHR)


  "NM_004248" in other vectors (4)

USD 98.00

USD 460.00


Availability*
In Stock

Size
    • 10 ug


Product images

Specifications

Product Data
Product Name GPR10 (PRLHR) (NM_004248) Human Tagged ORF Clone
Type Human Tagged ORF Clone
Tag Myc-DDK
Symbol PRLHR
Synonyms GPR10; GR3; PrRPR
Vector pCMV6-Entry
E. coli Selection Kanamycin (25 ug/mL)
Cell Selection Neomycin
Sequence Data
>RC210917 ORF sequence
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGGCCTCATCGACCACTCGGGGCCCCAGGGTTTCTGACTTATTTTCTGGGCTGCCGCCGGCGGTCACAA
CTCCCGCCAACCAGAGCGCAGAGGCCTCGGCGGGCAACGGGTCGGTGGCTGGCGCGGACGCTCCAGCCGT
CACGCCCTTCCAGAGCCTGCAGCTGGTGCATCAGCTGAAGGGGCTGATCGTGCTGCTCTACAGCGTCGTG
GTGGTCGTGGGGCTGGTGGGCAACTGCCTGCTGGTGCTGGTGATCGCGCGGGTGCGCCGGCTGCACAACG
TGACGAACTTCCTCATCGGCAACCTGGCCTTGTCCGACGTGCTCATGTGCACCGCCTGCGTGCCGCTCAC
GCTGGCCTATGCCTTCGAGCCACGCGGCTGGGTGTTCGGCGGCGGCCTGTGCCACCTGGTCTTCTTCCTG
CAGCCGGTCACCGTCTATGTGTCGGTGTTCACGCTCACCACCATCGCAGTGGACCGCTACGTCGTGCTGG
TGCACCCGCTGAGGCGGCGCATCTCGCTGCGCCTCAGCGCCTACGCTGTGCTGGCCATCTGGGCGCTGTC
CGCGGTGCTGGCGCTGCCCGCCGCCGTGCACACCTATCACGTGGAGCTCAAGCCGCACGACGTGCGCCTC
TGCGAGGAGTTCTGGGGCTCCCAGGAGCGCCAGCGCCAGCTCTACGCCTGGGGGCTGCTGCTGGTCACCT
ACCTGCTCCCTCTGCTGGTCATCCTCCTGTCTTACGTCCGGGTGTCAGTGAAGCTCCGCAACCGCGTGGT
GCCGGGCTGCGTGACCCAGAGCCAGGCCGACTGGGACCGCGCTCGGCGCCGGCGCACCTTCTGCTTGCTG
GTGGTGGTCGTGGTGGTGTTCGCCGTCTGCTGGCTGCCGCTGCACGTCTTCAACCTGCTGCGGGACCTCG
ACCCCCACGCCATCGACCCTTACGCCTTTGGGCTGGTGCAGCTGCTCTGCCACTGGCTCGCCATGAGTTC
GGCCTGCTACAACCCCTTCATCTACGCCTGGCTGCACGACAGCTTCCGCGAGGAGCTGCGCAAACTGTTG
GTCGCTTGGCCCCGCAAGATAGCCCCCCATGGCCAGAATATGACCGTCAGCGTGGTCATC


ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT
ACAAGGATGACGACGATAAG
GTTTAA
>RC210917 protein sequence
Red=Cloning site Green=Tags(s)

MASSTTRGPRVSDLFSGLPPAVTTPANQSAEASAGNGSVAGADAPAVTPFQSLQLVHQLKGLIVLLYSVV
VVVGLVGNCLLVLVIARVRRLHNVTNFLIGNLALSDVLMCTACVPLTLAYAFEPRGWVFGGGLCHLVFFL
QPVTVYVSVFTLTTIAVDRYVVLVHPLRRRISLRLSAYAVLAIWALSAVLALPAAVHTYHVELKPHDVRL
CEEFWGSQERQRQLYAWGLLLVTYLLPLLVILLSYVRVSVKLRNRVVPGCVTQSQADWDRARRRRTFCLL
VVVVVVFAVCWLPLHVFNLLRDLDPHAIDPYAFGLVQLLCHWLAMSSACYNPFIYAWLHDSFREELRKLL
VAWPRKIAPHGQNMTVSVVI

myc-FLAG tag
Chromatograms CHROMATOGRAMS
Sequencher program is needed, download here.
Restriction Sites SgfI-MluI      Cloning Scheme for this gene      Plasmid Map     
Tag Myc-DDK
ACCN NM_004248
ORF Size 1110 bp
OTI Disclaimer The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Product Components The ORF clone is ion-exchange column purified, transfection-ready dried plasmid DNA, and shipped with 2 vector sequencing primers.
Reference Data
RefSeq NM_004248.1, NM_004248.2, NP_004239.1
RefSeq Size 1980
RefSeq ORF 1113
Locus ID 2834
Cytogenetics 10q26.11
Protein Families Druggable Genome, GPCR, Transmembrane
Protein Pathways Neuroactive ligand-receptor interaction
MW 41.1 kDa
Gene Summary PRLHR is a 7-transmembrane domain receptor for prolactin-releasing hormone (PRLH; MIM 602663) that is highly expressed in anterior pituitary (Ozawa et al., 2002 [PubMed 11923475]). [supplied by OMIM, Mar 2008]

Other Versions

Other products for "PRLHR"
Frequently bought together (3)
Clone OTI4C5, Anti-DDK (FLAG) monoclonal antibody
    • 100 ul

USD 310.00


pCMV6-Entry, mammalian vector with C-terminal Myc- DDK Tag, 10ug
    • 10 ug

USD 570.00


Rabbit polyclonal anti-PRLHR antibody
    • 100 ul

USD 345.00

Customer Reviews 
Loading...
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.
68 Mouse Clones
Molbio tools