SMURF 2 (SMURF2) (NM_022739) Human Tagged ORF Clone

CAT#: RC210866

Reviews ()
Write a review

SMURF2 (Myc-DDK-tagged)-Human SMAD specific E3 ubiquitin protein ligase 2 (SMURF2)



  "NM_022739" in other vectors (6)

Reconstitution Protocol

USD 685.00

In Stock*

Size
    • 10 ug

Product images

Frequently bought together (4)
Clone OTI4C5, Anti-DDK (FLAG) monoclonal antibody
    • 30 ul

USD 177.00


pCMV6-Entry, mammalian vector with C-terminal Myc- DDK Tag, 10ug
    • 10 ug

USD 650.00


DH5α Chemically Competent Cells (≥10^8 cfu/μg of pUC19 DNA)
    • 5 x 200 ul

USD 160.00


Forward sequencing primer VP1.5, Reverse sequencing primer XL39, 100pmoles each
    • 100 pmol

USD 59.00

Other products for "SMURF2"

Specifications

Product Data
Type Human Tagged ORF Clone
Tag Myc-DDK
Symbol SMURF2
Vector pCMV6-Entry
E. coli Selection Kanamycin (25 ug/mL)
Mammalian Cell Selection Neomycin
Sequence Data
>RC210866 ORF sequence
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGTCTAACCCCGGAGGCCGGAGGAACGGGCCCGTCAAGCTGCGCCTGACAGTACTCTGTGCAAAAAACC
TGGTGAAAAAGGATTTTTTCCGACTTCCTGATCCATTTGCTAAGGTGGTGGTTGATGGATCTGGGCAATG
CCATTCTACAGATACTGTGAAGAATACGCTTGATCCAAAGTGGAATCAGCATTATGACCTGTATATTGGA
AAGTCTGATTCAGTTACGATCAGTGTATGGAATCACAAGAAGATCCATAAGAAACAAGGTGCTGGATTTC
TCGGTTGTGTTCGTCTTCTTTCCAATGCCATCAACCGCCTCAAAGACACTGGTTATCAGAGGTTGGATTT
ATGCAAACTCGGGCCAAATGACAATGATACAGTTAGAGGACAGATAGTAGTAAGTCTTCAGTCCAGAGAC
CGAATAGGCACAGGAGGACAAGTTGTGGACTGCAGTCGTTTATTTGATAACGATTTACCAGACGGCTGGG
AAGAAAGGAGAACCGCCTCTGGAAGAATCCAGTATCTAAACCATATAACAAGAACTACGCAATGGGAGCG
CCCAACACGACCGGCATCCGAATATTCTAGCCCTGGCAGACCTCTTAGCTGCTTTGTTGATGAGAACACT
CCAATTAGTGGAACAAATGGTGCAACATGTGGACAGTCTTCAGATCCCAGGCTGGCAGAGAGGAGAGTCA
GGTCACAACGACATAGAAATTACATGAGCAGAACACATTTACATACTCCTCCAGACCTACCAGAAGGCTA
TGAACAGAGGACAACGCAACAAGGCCAGGTGTATTTCTTACATACACAGACTGGTGTGAGCACATGGCAT
GATCCAAGAGTGCCCAGGGATCTTAGCAACATCAATTGTGAAGAGCTTGGTCCATTGCCTCCTGGATGGG
AGATCCGTAATACGGCAACAGGCAGAGTTTATTTCGTTGACCATAACAACAGAACAACACAATTTACAGA
TCCTCGGCTGTCTGCTAACTTGCATTTAGTTTTAAATCGGCAGAACCAATTGAAAGACCAACAGCAACAG
CAAGTGGTATCGTTATGTCCTGATGACACAGAATGCCTGACAGTCCCAAGGTACAAGCGAGACCTGGTTC
AGAAACTAAAAATTTTGCGGCAAGAACTTTCCCAACAACAGCCTCAGGCAGGTCATTGCCGCATTGAGGT
TTCCAGGGAAGAGATTTTTGAGGAATCATATCGACAGGTCATGAAAATGAGACCAAAAGATCTCTGGAAG
CGATTAATGATAAAATTTCGTGGAGAAGAAGGCCTTGACTATGGAGGCGTTGCCAGGGAATGGTTGTATC
TCTTGTCACATGAAATGTTGAATCCATACTATGGCCTCTTCCAGTATTCAAGAGATGATATTTATACATT
GCAGATCAATCCTGATTCTGCAGTTAATCCGGAACATTTATCCTATTTCCACTTTGTTGGACGAATAATG
GGAATGGCTGTGTTTCATGGACATTATATTGATGGTGGTTTCACATTGCCTTTTTATAAGCAATTGCTTG
GGAAGTCAATTACCTTGGATGACATGGAGTTAGTAGATCCGGATCTTCACAACAGTTTAGTGTGGATACT
TGAGAATGATATTACAGGTGTTTTGGACCATACCTTCTGTGTTGAACATAATGCATATGGTGAAATTATT
CAGCATGAACTTAAACCAAATGGCAAAAGTATCCCTGTTAATGAAGAAAATAAAAAAGAATATGTCAGGC
TCTATGTGAACTGGAGATTTTTACGAGGCATTGAGGCTCAATTCTTGGCTCTGCAGAAAGGATTTAATGA
AGTAATTCCACAACATCTGCTGAAGACATTTGATGAGAAGGAGTTAGAGCTCATTATTTGTGGACTTGGA
AAGATAGATGTTAATGACTGGAAGGTAAACACCCGGTTAAAACACTGTACACCAGACAGCAACATTGTCA
AATGGTTCTGGAAAGCTGTGGAGTTTTTTGATGAAGAGCGACGAGCAAGATTGCTTCAGTTTGTGACAGG
ATCCTCTCGAGTGCCTCTGCAGGGCTTCAAAGCATTGCAAGGTGCTGCAGGCCCGAGACTCTTTACCATA
CACCAGATTGATGCCTGCACTAACAACCTGCCGAAAGCCCACACTTGCTTCAATCGAATAGACATTCCAC
CCTATGAAAGCTATGAAAAGCTATATGAAAAGCTGCTAACAGCCATTGAAGAAACATGTGGATTTGCTGT
GGAA


ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT
ACAAGGATGACGACGATAAG
GTTTAA
>RC210866 protein sequence
Red=Cloning site Green=Tags(s)

MSNPGGRRNGPVKLRLTVLCAKNLVKKDFFRLPDPFAKVVVDGSGQCHSTDTVKNTLDPKWNQHYDLYIG
KSDSVTISVWNHKKIHKKQGAGFLGCVRLLSNAINRLKDTGYQRLDLCKLGPNDNDTVRGQIVVSLQSRD
RIGTGGQVVDCSRLFDNDLPDGWEERRTASGRIQYLNHITRTTQWERPTRPASEYSSPGRPLSCFVDENT
PISGTNGATCGQSSDPRLAERRVRSQRHRNYMSRTHLHTPPDLPEGYEQRTTQQGQVYFLHTQTGVSTWH
DPRVPRDLSNINCEELGPLPPGWEIRNTATGRVYFVDHNNRTTQFTDPRLSANLHLVLNRQNQLKDQQQQ
QVVSLCPDDTECLTVPRYKRDLVQKLKILRQELSQQQPQAGHCRIEVSREEIFEESYRQVMKMRPKDLWK
RLMIKFRGEEGLDYGGVAREWLYLLSHEMLNPYYGLFQYSRDDIYTLQINPDSAVNPEHLSYFHFVGRIM
GMAVFHGHYIDGGFTLPFYKQLLGKSITLDDMELVDPDLHNSLVWILENDITGVLDHTFCVEHNAYGEII
QHELKPNGKSIPVNEENKKEYVRLYVNWRFLRGIEAQFLALQKGFNEVIPQHLLKTFDEKELELIICGLG
KIDVNDWKVNTRLKHCTPDSNIVKWFWKAVEFFDEERRARLLQFVTGSSRVPLQGFKALQGAAGPRLFTI
HQIDACTNNLPKAHTCFNRIDIPPYESYEKLYEKLLTAIEETCGFAVE

myc-FLAG tag
Chromatograms CHROMATOGRAMS
Sequencher program is needed, download here.
Restriction Sites SgfI-MluI      Cloning Scheme for this gene      Plasmid Map     
ACCN NM_022739
ORF Size 2244 bp
OTI Disclaimer The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Product Components The ORF clone is ion-exchange column purified and shipped in a 2D barcoded Matrix tube containing 10ug of transfection-ready, dried plasmid DNA (reconstitute with 100 ul of water).
Reconstitution 1. Centrifuge at 5,000xg for 5min.
2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA.
3. Close the tube and incubate for 10 minutes at room temperature.
4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom.
5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C.
Reference Data
RefSeq NM_022739.4
RefSeq Size 3866 bp
RefSeq ORF 2247 bp
Locus ID 64750
UniProt ID Q9HAU4
Cytogenetics 17q23.3-q24.1
Domains C2, HECT, WW
Protein Families Adult stem cells, Druggable Genome, ES Cell Differentiation/IPS, Transcription Factors
Protein Pathways Allograft rejection, Antigen processing and presentation, Autoimmune thyroid disease, Cell adhesion molecules (CAMs), Endocytosis, Graft-versus-host disease, TGF-beta signaling pathway, Type I diabetes mellitus, Ubiquitin mediated proteolysis, Viral myocarditis
MW 86.2 kDa
Gene Summary E3 ubiquitin-protein ligase which accepts ubiquitin from an E2 ubiquitin-conjugating enzyme in the form of a thioester and then directly transfers the ubiquitin to targeted substrates. Interacts with SMAD1 and SMAD7 in order to trigger their ubiquitination and proteasome-dependent degradation. In addition, interaction with SMAD7 activates autocatalytic degradation, which is prevented by interaction with SCYE1. Forms a stable complex with the TGF-beta receptor-mediated phosphorylated SMAD2 and SMAD3. In this way, SMAD2 may recruit substrates, such as SNON, for ubiquitin-mediated degradation. Enhances the inhibitory activity of SMAD7 and reduces the transcriptional activity of SMAD2. Coexpression of SMURF2 with SMAD1 results in considerable decrease in steady-state level of SMAD1 protein and a smaller decrease of SMAD2 level.[UniProtKB/Swiss-Prot Function]

Other Versions

Customer Reviews 
Loading...
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.