Rho GTPase activating protein 29 (ARHGAP29) (NM_004815) Human Tagged ORF Clone

CAT#: RC210830

Reviews ()
Write a review

ARHGAP29 (Myc-DDK-tagged)-Human Rho GTPase activating protein 29 (ARHGAP29)



  "NM_004815" in other vectors (6)

USD 600.00


Availability*
In Stock

Size
    • 10 ug


Product images

Specifications

Product Data
Product Name Rho GTPase activating protein 29 (ARHGAP29) (NM_004815) Human Tagged ORF Clone
Type Human Tagged ORF Clone
Tag Myc-DDK
Symbol ARHGAP29
Synonyms PARG1
Vector pCMV6-Entry
E. coli Selection Kanamycin (25 ug/mL)
Cell Selection Neomycin
Sequence Data
>RC210830 ORF sequence
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGATTGCTCACAAACAGAAAAAGACAAAGAAAAAACGTGCTTGGGCATCAGGTCAACTCTCTACTGATA
TTACAACTTCTGAAATGGGGCTCAAGTCCTTAAGTTCCAACTCTATTTTTGATCCGGATTACATCAAGGA
GTTGGTGAATGATATCAGGAAGTTCTCCCACATGTTACTATATTTGAAAGAAGCCATATTTTCAGACTGT
TTTAAAGAAGTTATTCATATACGTCTAGAGGAACTGCTCCGTGTTTTAAAGTCTATAATGAATAAACATC
AGAACCTCAATTCTGTTGATCTTCAAAATGCTGCAGAAATGCTCACTGCAAAAGTGAAAGCTGTGAACTT
CACAGAAGTTAATGAAGAAAACAAAAACGATCTCTTCCAGGAAGTGTTTTCTTCTATTGAAACTTTGGCA
TTTACCTTTGGAAATATCCTTACAAACTTCCTTATGGGAGATGTAGGCAATGATTCATTATTGCGACTGC
CTGTTTCTCGAGAAACTAAGTCGTTTGAAAATGTTTCTGTGGAATCAGTGGACTCATCCAGTGAAAAAGG
AAATTTTTCCCCTTTAGAACTAGACAACGTGCTGTTAAAGAACACTGACTCTATCGAGCTGGCTTTGTCA
TATGCTAAAACTTGGTCAAAATATACTAAGAACATAGTTTCATGGGTTGAAAAAAAGCTTAACTTGGAAT
TGGAGTCCACTAGAAATATGGTCAAGTTGGCAGAGGCAACTAGAACTAACATTGGAATTCAGGAGTTCAT
GCCACTGCAGTCTCTGTTTACTAATGCTCTTCTTAATGATATAGAAAGCAGTCACCTTTTACAACAAACA
ATTGCAGCTCTCCAGGCTAACAAATTTGTGCAGCCTCTACTTGGAAGGAAAAATGAAATGGAAAAACAAA
GGAAAGAAATAAAAGAGCTTTGGAAACAGGAGCAAAATAAAATGCTTGAAGCAGAGAATGCTCTCAAAAA
GGCAAAATTATTATGCATGCAACGTCAAGATGAATATGAGAAAGCAAAGTCTTCCATGTTTCGTGCAGAA
GAGGAGCATCTGTCTTCAAGTGGCGGATTAGCAAAAAATCTCAACAAGCAACTAGAAAAAAAGCGAAGGT
TGGAAGAGGAGGCTCTCCAAAAAGTAGAAGAAGCAAATGAACTTTACAAAGTTTGTGTGACAAATGTTGA
AGAAAGAAGAAATGATCTAGAAAATACCAAAAGAGAAATTTTAGCACAACTCCGGACACTTGTTTTCCAG
TGTGATCTTACCCTTAAAGCTGTAACAGTTAACCTCTTCCACATGCAGCATCTGCAGGCTGCTTCCCTTG
CAGACAGTTTACAGTCTCTCTGTGATAGTGCCAAACTCTATGACCCAGGCCAAGAGTACAGTGAATTTGT
CAAGGCCACAAATTCAACTGAAGAAGAAAAAGTTGATGGAAATGTAAATAAACATTTAAATAGTTCCCAA
CCTTCAGGATTTGGACCTGCCAACTCTTTAGAGGATGTTGTACGCCTTCCTGACAGTTCTAATAAAATTG
AAGAGGACAGATGCTCTAACAGTGCAGATATAACAGGTCCTTCCTTTATAAGATCATGGACATTTGGGAT
GTTTAGTGATTCTGAGAGCACTGGAGGGAGCAGCGAATCTAGATCTCTGGATTCAGAATCTATAAGTCCA
GGAGACTTTCATCGAAAACTTCCACGAACACCATCCAGTGGAACTATGTCCTCTGCAGATGATCTAGATG
AAAGAGAGCCACCTTCCCCTTCAGAAACTGGACCCAATTCCCTTGGAACATTTAAGAAAACATTGATGTC
AAAGGCAGCTCTCACACACAAGTTTCGCAAATTGAGATCCCCCACGAAATGTAGGGATTGTGAAGGCATT
GTAGTGTTCCAAGGTGTTGAATGTGAAGAGTGTCTCCTTGTTTGTCATCGAAAGTGTTTGGAAAATTTAG
TCATTATTTGTGGTCATCAGAAACTTCCAGGAAAAATACACTTATTTGGAGCAGAATTCACACAAGTTGC
AAAAAAGGAACCAGATGGTATCCCTTTTATACTCAAAATATGTGCCTCAGAGATTGAAAATAGAGCTTTG
TGTCTACAGGGAATTTATCGTGTGTGTGGAAACAAAATAAAAACTGAAAAATTGTGTCAAGCTTTGGAAA
ATGGAATGCACTTGGTAGATATTTCAGAATTTAGTTCACATGATATCTGTGACGTCTTGAAATTATACCT
TCGGCAGCTCCCAGAACCATTTATTTTATTTCGATTGTACAAGGAATTTATAGACCTTGCAAAAGAGATC
CAACATGTAAATGAAGAACAAGAGACAAAAAAGAATAGTCTTGAAGACAAAAAATGGCCAAATATGTGTA
TAGAAATAAACCGAATTCTTCTAAAAAGCAAAGACCTTCTAAGACAATTGCCAGCATCAAATTTTAACAG
TCTTCATTTCCTTATAGTACATCTAAAGCGGGTAGTAGATCATGCAGAAGAAAACAAGATGAACTCCAAA
AACTTGGGGGTGATATTTGGACCAAGTCTCATTAGGCCAAGGCCCACAACTGCTCCTATCACCATCTCCT
CCCTTGCAGAGTATTCAAATCAAGCACGCTTGGTAGAGTTTCTCATTACTTACTCACAGAAGATCTTCGA
TGGGTCCCTACAACCACAAGATGTTATGTGTAGCATAGGTGTTGTTGATCAAGGCTGTTTTCCAAAGCCT
CTGTTATCACCAGAAGAAAGAGACATTGAACGTTCCATGAAGTCACTATTTTTTTCTTCAAAGGAAGATA
TCCATACTTCAGAGAGTGAAAGCAAAATTTTTGAACGAGCTACATCATTTGAGGAATCAGAACGCAAGCA
AAATGCGTTAGGAAAATGTGATGCATGTCTCAGTGACAAAGCACAGTTGCTTCTAGACCAAGAGGCTGAA
TCAGCATCCCAAAAGATAGAAGATGGTAAAACCCCTAAGCCACTTTCTCTGAAATCTGATAGGTCAACAA
ACAATGTGGAGAGGCATACTCCAAGGACCAAGATTAGACCTGTAAGTTTGCCTGTAGATAGACTACTTCT
TGCAAGTCCTCCTAATGAGAGAAATGGCAGAAATATGGGAAATGTAAATTTAGACAAGTTTTGCAAGAAT
CCTGCCTTTGAAGGAGTTAATAGAAAAGACGCTGCTACTACTGTTTGTTCCAAATTTAATGGCTTTGACC
AGCAAACTCTACAGAAAATTCAGGACAAACAGTATGAACAAAACAGCCTAACTGCCAAGACTACAATGAT
CATGCCCAGTGCACTCCAGGAAAAAGGAGTGACAACAAGCCTCCAGATTAGTGGGGACCATTCTATCAAT
GCCACTCAACCCAGTAAGCCATATGCAGAGCCAGTCAGGTCAGTGAGAGAGGCATCTGAGAGACGGTCTT
CAGATTCCTACCCTCTCGCTCCTGTCAGAGCACCCAGAACACTGCAGCCTCAACATTGGACAACATTTTA
TAAACCACATGCTCCCATCATCAGTATCAGGGGGAATGAGGAGAAGCCAGCTTCACCCTCAGCAGCAGTG
CCTCCTGGCACAGATCACGATCCCCACGGTCTCGTGGTGAAGTCAATGCCAGACCCAGACAAAGCATCAG
CTTGTCCTGGGCAAGCAACTGGTCAACCTAAAGAAGACTCTGAGGAGCTTGGCTTGCCTGATGTGAATCC
AATGTGTCAGAGACCAAGGCTAAAACGAATGCAACAGTTTGAAGACCTCGAAGATGAAATTCCACAATTT
GTG


ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT
ACAAGGATGACGACGATAAG
GTTTAA
>RC210830 protein sequence
Red=Cloning site Green=Tags(s)

MIAHKQKKTKKKRAWASGQLSTDITTSEMGLKSLSSNSIFDPDYIKELVNDIRKFSHMLLYLKEAIFSDC
FKEVIHIRLEELLRVLKSIMNKHQNLNSVDLQNAAEMLTAKVKAVNFTEVNEENKNDLFQEVFSSIETLA
FTFGNILTNFLMGDVGNDSLLRLPVSRETKSFENVSVESVDSSSEKGNFSPLELDNVLLKNTDSIELALS
YAKTWSKYTKNIVSWVEKKLNLELESTRNMVKLAEATRTNIGIQEFMPLQSLFTNALLNDIESSHLLQQT
IAALQANKFVQPLLGRKNEMEKQRKEIKELWKQEQNKMLEAENALKKAKLLCMQRQDEYEKAKSSMFRAE
EEHLSSSGGLAKNLNKQLEKKRRLEEEALQKVEEANELYKVCVTNVEERRNDLENTKREILAQLRTLVFQ
CDLTLKAVTVNLFHMQHLQAASLADSLQSLCDSAKLYDPGQEYSEFVKATNSTEEEKVDGNVNKHLNSSQ
PSGFGPANSLEDVVRLPDSSNKIEEDRCSNSADITGPSFIRSWTFGMFSDSESTGGSSESRSLDSESISP
GDFHRKLPRTPSSGTMSSADDLDEREPPSPSETGPNSLGTFKKTLMSKAALTHKFRKLRSPTKCRDCEGI
VVFQGVECEECLLVCHRKCLENLVIICGHQKLPGKIHLFGAEFTQVAKKEPDGIPFILKICASEIENRAL
CLQGIYRVCGNKIKTEKLCQALENGMHLVDISEFSSHDICDVLKLYLRQLPEPFILFRLYKEFIDLAKEI
QHVNEEQETKKNSLEDKKWPNMCIEINRILLKSKDLLRQLPASNFNSLHFLIVHLKRVVDHAEENKMNSK
NLGVIFGPSLIRPRPTTAPITISSLAEYSNQARLVEFLITYSQKIFDGSLQPQDVMCSIGVVDQGCFPKP
LLSPEERDIERSMKSLFFSSKEDIHTSESESKIFERATSFEESERKQNALGKCDACLSDKAQLLLDQEAE
SASQKIEDGKTPKPLSLKSDRSTNNVERHTPRTKIRPVSLPVDRLLLASPPNERNGRNMGNVNLDKFCKN
PAFEGVNRKDAATTVCSKFNGFDQQTLQKIQDKQYEQNSLTAKTTMIMPSALQEKGVTTSLQISGDHSIN
ATQPSKPYAEPVRSVREASERRSSDSYPLAPVRAPRTLQPQHWTTFYKPHAPIISIRGNEEKPASPSAAV
PPGTDHDPHGLVVKSMPDPDKASACPGQATGQPKEDSEELGLPDVNPMCQRPRLKRMQQFEDLEDEIPQF
V

myc-FLAG tag
Chromatograms CHROMATOGRAMS
Sequencher program is needed, download here.
Restriction Sites SgfI-MluI      Cloning Scheme for this gene      Plasmid Map     
Tag Myc-DDK
ACCN NM_004815
ORF Size 3783 bp
OTI Disclaimer The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Product Components The ORF clone is ion-exchange column purified, transfection-ready dried plasmid DNA, and shipped with 2 vector sequencing primers.
Reconstitution 1. Centrifuge at 5,000xg for 5min.
2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA.
3. Close the tube and incubate for 10 minutes at room temperature.
4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom.
5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C.
Reference Data
RefSeq NM_004815.2, NM_004815.3, NP_004806.2
RefSeq Size 9121 bp
RefSeq ORF 3786 bp
Locus ID 9411
Cytogenetics 1p22.1
Domains RhoGAP, DAG_PE-bind
MW 142.1 kDa
Gene Summary Rap1 is a small GTPase that, through effectors, regulates Rho GTPase signaling. These effectors- Rasip1, Radil, and the protein encoded by this gene- translocate to the cell membrane, where they form a multiprotein complex. This complex is necessary for Rap1-induced inhibition of Rho signaling. Defects in this gene may be a cause of nonsyndromic cleft lip with or without cleft palate. [provided by RefSeq, Jun 2016]

Citations (1)

Other Versions

Other products for "ARHGAP29"
Frequently bought together (2)
Clone OTI4C5, Anti-DDK (FLAG) monoclonal antibody
    • 100 ul

USD 310.00


pCMV6-Entry, mammalian vector with C-terminal Myc- DDK Tag, 10ug
    • 10 ug

USD 570.00

Customer Reviews 
Loading...
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.
68 Mouse Clones
Molbio tools