Rho GTPase activating protein 29(ARHGAP29) (NM_004815) Human Tagged ORF Clone

CAT#: RC210830

ARHGAP29 (Myc-DDK-tagged)-Human Rho GTPase activating protein 29 (ARHGAP29)

Clone Modification / Custom Cloning Service

USD 824.00


Availability*
In Stock

Size
    • 10 ug

Product images

Specifications

Product Data
Product Name Rho GTPase activating protein 29(ARHGAP29) (NM_004815) Human Tagged ORF Clone
Symbol ARHGAP29
Synonyms PARG1; PARG1
Vector pCMV6-Entry
Sequence Data
>RC210830 representing NM_004815
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGATTGCTCACAAACAGAAAAAGACAAAGAAAAAACGTGCTTGGGCATCAGGTCAACTCTCTACTGATA
TTACAACTTCTGAAATGGGGCTCAAGTCCTTAAGTTCCAACTCTATTTTTGATCCGGATTACATCAAGGA
GTTGGTGAATGATATCAGGAAGTTCTCCCACATGTTACTATATTTGAAAGAAGCCATATTTTCAGACTGT
TTTAAAGAAGTTATTCATATACGTCTAGAGGAACTGCTCCGTGTTTTAAAGTCTATAATGAATAAACATC
AGAACCTCAATTCTGTTGATCTTCAAAATGCTGCAGAAATGCTCACTGCAAAAGTGAAAGCTGTGAACTT
CACAGAAGTTAATGAAGAAAACAAAAACGATCTCTTCCAGGAAGTGTTTTCTTCTATTGAAACTTTGGCA
TTTACCTTTGGAAATATCCTTACAAACTTCCTTATGGGAGATGTAGGCAATGATTCATTATTGCGACTGC
CTGTTTCTCGAGAAACTAAGTCGTTTGAAAATGTTTCTGTGGAATCAGTGGACTCATCCAGTGAAAAAGG
AAATTTTTCCCCTTTAGAACTAGACAACGTGCTGTTAAAGAACACTGACTCTATCGAGCTGGCTTTGTCA
TATGCTAAAACTTGGTCAAAATATACTAAGAACATAGTTTCATGGGTTGAAAAAAAGCTTAACTTGGAAT
TGGAGTCCACTAGAAATATGGTCAAGTTGGCAGAGGCAACTAGAACTAACATTGGAATTCAGGAGTTCAT
GCCACTGCAGTCTCTGTTTACTAATGCTCTTCTTAATGATATAGAAAGCAGTCACCTTTTACAACAAACA
ATTGCAGCTCTCCAGGCTAACAAATTTGTGCAGCCTCTACTTGGAAGGAAAAATGAAATGGAAAAACAAA
GGAAAGAAATAAAAGAGCTTTGGAAACAGGAGCAAAATAAAATGCTTGAAGCAGAGAATGCTCTCAAAAA
GGCAAAATTATTATGCATGCAACGTCAAGATGAATATGAGAAAGCAAAGTCTTCCATGTTTCGTGCAGAA
GAGGAGCATCTGTCTTCAAGTGGCGGATTAGCAAAAAATCTCAACAAGCAACTAGAAAAAAAGCGAAGGT
TGGAAGAGGAGGCTCTCCAAAAAGTAGAAGAAGCAAATGAACTTTACAAAGTTTGTGTGACAAATGTTGA
AGAAAGAAGAAATGATCTAGAAAATACCAAAAGAGAAATTTTAGCACAACTCCGGACACTTGTTTTCCAG
TGTGATCTTACCCTTAAAGCTGTAACAGTTAACCTCTTCCACATGCAGCATCTGCAGGCTGCTTCCCTTG
CAGACAGTTTACAGTCTCTCTGTGATAGTGCCAAACTCTATGACCCAGGCCAAGAGTACAGTGAATTTGT
CAAGGCCACAAATTCAACTGAAGAAGAAAAAGTTGATGGAAATGTAAATAAACATTTAAATAGTTCCCAA
CCTTCAGGATTTGGACCTGCCAACTCTTTAGAGGATGTTGTACGCCTTCCTGACAGTTCTAATAAAATTG
AAGAGGACAGATGCTCTAACAGTGCAGATATAACAGGTCCTTCCTTTATAAGATCATGGACATTTGGGAT
GTTTAGTGATTCTGAGAGCACTGGAGGGAGCAGCGAATCTAGATCTCTGGATTCAGAATCTATAAGTCCA
GGAGACTTTCATCGAAAACTTCCACGAACACCATCCAGTGGAACTATGTCCTCTGCAGATGATCTAGATG
AAAGAGAGCCACCTTCCCCTTCAGAAACTGGACCCAATTCCCTTGGAACATTTAAGAAAACATTGATGTC
AAAGGCAGCTCTCACACACAAGTTTCGCAAATTGAGATCCCCCACGAAATGTAGGGATTGTGAAGGCATT
GTAGTGTTCCAAGGTGTTGAATGTGAAGAGTGTCTCCTTGTTTGTCATCGAAAGTGTTTGGAAAATTTAG
TCATTATTTGTGGTCATCAGAAACTTCCAGGAAAAATACACTTATTTGGAGCAGAATTCACACAAGTTGC
AAAAAAGGAACCAGATGGTATCCCTTTTATACTCAAAATATGTGCCTCAGAGATTGAAAATAGAGCTTTG
TGTCTACAGGGAATTTATCGTGTGTGTGGAAACAAAATAAAAACTGAAAAATTGTGTCAAGCTTTGGAAA
ATGGAATGCACTTGGTAGATATTTCAGAATTTAGTTCACATGATATCTGTGACGTCTTGAAATTATACCT
TCGGCAGCTCCCAGAACCATTTATTTTATTTCGATTGTACAAGGAATTTATAGACCTTGCAAAAGAGATC
CAACATGTAAATGAAGAACAAGAGACAAAAAAGAATAGTCTTGAAGACAAAAAATGGCCAAATATGTGTA
TAGAAATAAACCGAATTCTTCTAAAAAGCAAAGACCTTCTAAGACAATTGCCAGCATCAAATTTTAACAG
TCTTCATTTCCTTATAGTACATCTAAAGCGGGTAGTAGATCATGCAGAAGAAAACAAGATGAACTCCAAA
AACTTGGGGGTGATATTTGGACCAAGTCTCATTAGGCCAAGGCCCACAACTGCTCCTATCACCATCTCCT
CCCTTGCAGAGTATTCAAATCAAGCACGCTTGGTAGAGTTTCTCATTACTTACTCACAGAAGATCTTCGA
TGGGTCCCTACAACCACAAGATGTTATGTGTAGCATAGGTGTTGTTGATCAAGGCTGTTTTCCAAAGCCT
CTGTTATCACCAGAAGAAAGAGACATTGAACGTTCCATGAAGTCACTATTTTTTTCTTCAAAGGAAGATA
TCCATACTTCAGAGAGTGAAAGCAAAATTTTTGAACGAGCTACATCATTTGAGGAATCAGAACGCAAGCA
AAATGCGTTAGGAAAATGTGATGCATGTCTCAGTGACAAAGCACAGTTGCTTCTAGACCAAGAGGCTGAA
TCAGCATCCCAAAAGATAGAAGATGGTAAAACCCCTAAGCCACTTTCTCTGAAATCTGATAGGTCAACAA
ACAATGTGGAGAGGCATACTCCAAGGACCAAGATTAGACCTGTAAGTTTGCCTGTAGATAGACTACTTCT
TGCAAGTCCTCCTAATGAGAGAAATGGCAGAAATATGGGAAATGTAAATTTAGACAAGTTTTGCAAGAAT
CCTGCCTTTGAAGGAGTTAATAGAAAAGACGCTGCTACTACTGTTTGTTCCAAATTTAATGGCTTTGACC
AGCAAACTCTACAGAAAATTCAGGACAAACAGTATGAACAAAACAGCCTAACTGCCAAGACTACAATGAT
CATGCCCAGTGCACTCCAGGAAAAAGGAGTGACAACAAGCCTCCAGATTAGTGGGGACCATTCTATCAAT
GCCACTCAACCCAGTAAGCCATATGCAGAGCCAGTCAGGTCAGTGAGAGAGGCATCTGAGAGACGGTCTT
CAGATTCCTACCCTCTCGCTCCTGTCAGAGCACCCAGAACACTGCAGCCTCAACATTGGACAACATTTTA
TAAACCACATGCTCCCATCATCAGTATCAGGGGGAATGAGGAGAAGCCAGCTTCACCCTCAGCAGCAGTG
CCTCCTGGCACAGATCACGATCCCCACGGTCTCGTGGTGAAGTCAATGCCAGACCCAGACAAAGCATCAG
CTTGTCCTGGGCAAGCAACTGGTCAACCTAAAGAAGACTCTGAGGAGCTTGGCTTGCCTGATGTGAATCC
AATGTGTCAGAGACCAAGGCTAAAACGAATGCAACAGTTTGAAGACCTCGAAGATGAAATTCCACAATTT
GTG


ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT
ACAAGGATGACGACGATAAG
GTTTAA
>RC210830 representing NM_004815
Red=Cloning site Green=Tags(s)

MIAHKQKKTKKKRAWASGQLSTDITTSEMGLKSLSSNSIFDPDYIKELVNDIRKFSHMLLYLKEAIFSDC
FKEVIHIRLEELLRVLKSIMNKHQNLNSVDLQNAAEMLTAKVKAVNFTEVNEENKNDLFQEVFSSIETLA
FTFGNILTNFLMGDVGNDSLLRLPVSRETKSFENVSVESVDSSSEKGNFSPLELDNVLLKNTDSIELALS
YAKTWSKYTKNIVSWVEKKLNLELESTRNMVKLAEATRTNIGIQEFMPLQSLFTNALLNDIESSHLLQQT
IAALQANKFVQPLLGRKNEMEKQRKEIKELWKQEQNKMLEAENALKKAKLLCMQRQDEYEKAKSSMFRAE
EEHLSSSGGLAKNLNKQLEKKRRLEEEALQKVEEANELYKVCVTNVEERRNDLENTKREILAQLRTLVFQ
CDLTLKAVTVNLFHMQHLQAASLADSLQSLCDSAKLYDPGQEYSEFVKATNSTEEEKVDGNVNKHLNSSQ
PSGFGPANSLEDVVRLPDSSNKIEEDRCSNSADITGPSFIRSWTFGMFSDSESTGGSSESRSLDSESISP
GDFHRKLPRTPSSGTMSSADDLDEREPPSPSETGPNSLGTFKKTLMSKAALTHKFRKLRSPTKCRDCEGI
VVFQGVECEECLLVCHRKCLENLVIICGHQKLPGKIHLFGAEFTQVAKKEPDGIPFILKICASEIENRAL
CLQGIYRVCGNKIKTEKLCQALENGMHLVDISEFSSHDICDVLKLYLRQLPEPFILFRLYKEFIDLAKEI
QHVNEEQETKKNSLEDKKWPNMCIEINRILLKSKDLLRQLPASNFNSLHFLIVHLKRVVDHAEENKMNSK
NLGVIFGPSLIRPRPTTAPITISSLAEYSNQARLVEFLITYSQKIFDGSLQPQDVMCSIGVVDQGCFPKP
LLSPEERDIERSMKSLFFSSKEDIHTSESESKIFERATSFEESERKQNALGKCDACLSDKAQLLLDQEAE
SASQKIEDGKTPKPLSLKSDRSTNNVERHTPRTKIRPVSLPVDRLLLASPPNERNGRNMGNVNLDKFCKN
PAFEGVNRKDAATTVCSKFNGFDQQTLQKIQDKQYEQNSLTAKTTMIMPSALQEKGVTTSLQISGDHSIN
ATQPSKPYAEPVRSVREASERRSSDSYPLAPVRAPRTLQPQHWTTFYKPHAPIISIRGNEEKPASPSAAV
PPGTDHDPHGLVVKSMPDPDKASACPGQATGQPKEDSEELGLPDVNPMCQRPRLKRMQQFEDLEDEIPQF
V

myc-FLAG tag
Chromatograms CHROMATOGRAMS
Sequencher program is needed, download here.
Restriction Sites SgfI-MluI      Cloning Scheme for this gene      Plasmid Map     
Tag Myc-DDK
ACCN NM_004815
ORF Size 3783 bp
OTI Disclaimer The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Product Components The ORF clone is ion-exchange column purified, transfection-ready dried plasmid DNA, and shipped with 2 vector sequencing primers.
Reference Data
RefSeq NM_004815.2, NM_004815.3, NP_004806
RefSeq Size 5585
RefSeq ORF 3786
Locus ID 9411
Cytogenetics 1p22.1
Domains RhoGAP, C1
MW 141.9 kDa
Gene Summary Rap1 is a small GTPase that, through effectors, regulates Rho GTPase signaling. These effectors- Rasip1, Radil, and the protein encoded by this gene- translocate to the cell membrane, where they form a multiprotein complex. This complex is necessary for Rap1-induced inhibition of Rho signaling. Defects in this gene may be a cause of nonsyndromic cleft lip with or without cleft palate. [provided by RefSeq, Jun 2016].
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Citations (1)