EGF (NM_001963) Human Tagged ORF Clone

CAT#: RC210817

EGF (Myc-DDK-tagged)-Human epidermal growth factor (EGF), transcript variant 1

Need custom modification / cloning service?
Get a free quote

USD 824.00


Availability*
In Stock

Size
    • 10 ug

Cited in 1 publication.

Product images

Specifications

Product Data
Product Name EGF (NM_001963) Human Tagged ORF Clone
Symbol EGF
Synonyms HOMG4; URG
Vector pCMV6-Entry
Sequence Data
>RC210817 representing NM_001963
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGCTGCTCACTCTTATCATTCTGTTGCCAGTAGTTTCAAAATTTAGTTTTGTTAGTCTCTCAGCACCGC
AGCACTGGAGCTGTCCTGAAGGTACTCTCGCAGGAAATGGGAATTCTACTTGTGTGGGTCCTGCACCCTT
CTTAATTTTCTCCCATGGAAATAGTATCTTTAGGATTGACACAGAAGGAACCAATTATGAGCAATTGGTG
GTGGATGCTGGTGTCTCAGTGATCATGGATTTTCATTATAATGAGAAAAGAATCTATTGGGTGGATTTAG
AAAGACAACTTTTGCAAAGAGTTTTTCTGAATGGGTCAAGGCAAGAGAGAGTATGTAATATAGAGAAAAA
TGTTTCTGGAATGGCAATAAATTGGATAAATGAAGAAGTTATTTGGTCAAATCAACAGGAAGGAATCATT
ACAGTAACAGATATGAAAGGAAATAATTCCCACATTCTTTTAAGTGCTTTAAAATATCCTGCAAATGTAG
CAGTTGATCCAGTAGAAAGGTTTATATTTTGGTCTTCAGAGGTGGCTGGAAGCCTTTATAGAGCAGATCT
CGATGGTGTGGGAGTGAAGGCTCTGTTGGAGACATCAGAGAAAATAACAGCTGTGTCATTGGATGTGCTT
GATAAGCGGCTGTTTTGGATTCAGTACAACAGAGAAGGAAGCAATTCTCTTATTTGCTCCTGTGATTATG
ATGGAGGTTCTGTCCACATTAGTAAACATCCAACACAGCATAATTTGTTTGCAATGTCCCTTTTTGGTGA
CCGTATCTTCTATTCAACATGGAAAATGAAGACAATTTGGATAGCCAACAAACACACTGGAAAGGACATG
GTTAGAATTAACCTCCATTCATCATTTGTACCACTTGGTGAACTGAAAGTAGTGCATCCACTTGCACAAC
CCAAGGCAGAAGATGACACTTGGGAGCCTGAGCAGAAACTTTGCAAATTGAGGAAAGGAAACTGCAGCAG
CACTGTGTGTGGGCAAGACCTCCAGTCACACTTGTGCATGTGTGCAGAGGGATACGCCCTAAGTCGAGAC
CGGAAGTACTGTGAAGATGTTAATGAATGTGCTTTTTGGAATCATGGCTGTACTCTTGGGTGTAAAAACA
CCCCTGGATCCTATTACTGCACGTGCCCTGTAGGATTTGTTCTGCTTCCTGATGGGAAACGATGTCATCA
ACTTGTTTCCTGTCCACGCAATGTGTCTGAATGCAGCCATGACTGTGTTCTGACATCAGAAGGTCCCTTA
TGTTTCTGTCCTGAAGGCTCAGTGCTTGAGAGAGATGGGAAAACATGTAGCGGTTGTTCCTCACCCGATA
ATGGTGGATGTAGCCAGCTCTGCGTTCCTCTTAGCCCAGTATCCTGGGAATGTGATTGCTTTCCTGGGTA
TGACCTACAACTGGATGAAAAAAGCTGTGCAGCTTCAGGACCACAACCATTTTTGCTGTTTGCCAATTCT
CAAGATATTCGACACATGCATTTTGATGGAACAGACTATGGAACTCTGCTCAGCCAGCAGATGGGAATGG
TTTATGCCCTAGATCATGACCCTGTGGAAAATAAGATATACTTTGCCCATACAGCCCTGAAGTGGATAGA
GAGAGCTAATATGGATGGTTCCCAGCGAGAAAGGCTTATTGAGGAAGGAGTAGATGTGCCAGAAGGTCTT
GCTGTGGACTGGATTGGCCGTAGATTCTATTGGACAGACAGAGGGAAATCTCTGATTGGAAGGAGTGATT
TAAATGGGAAACGTTCCAAAATAATCACTAAGGAGAACATCTCTCAACCACGAGGAATTGCTGTTCATCC
AATGGCCAAGAGATTATTCTGGACTGATACAGGGATTAATCCACGAATTGAAAGTTCTTCCCTCCAAGGC
CTTGGCCGTCTGGTTATAGCCAGCTCTGATCTAATCTGGCCCAGTGGAATAACGATTGACTTCTTAACTG
ACAAGTTGTACTGGTGCGATGCCAAGCAGTCTGTGATTGAAATGGCCAATCTGGATGGTTCAAAACGCCG
AAGACTTACCCAGAATGATGTAGGTCACCCATTTGCTGTAGCAGTGTTTGAGGATTATGTGTGGTTCTCA
GATTGGGCTATGCCATCAGTAATAAGAGTAAACAAGAGGACTGGCAAAGATAGAGTACGTCTCCAAGGCA
GCATGCTGAAGCCCTCATCACTGGTTGTGGTTCATCCATTGGCAAAACCAGGAGCAGATCCCTGCTTATA
TCAAAACGGAGGCTGTGAACATATTTGCAAAAAGAGGCTTGGAACTGCTTGGTGTTCGTGTCGTGAAGGT
TTTATGAAAGCCTCAGATGGGAAAACGTGTCTGGCTCTGGATGGTCATCAGCTGTTGGCAGGTGGTGAAG
TTGATCTAAAGAACCAAGTAACACCATTGGACATCTTGTCCAAGACTAGAGTGTCAGAAGATAACATTAC
AGAATCTCAACACATGCTAGTGGCTGAAATCATGGTGTCAGATCAAGATGACTGTGCTCCTGTGGGATGC
AGCATGTATGCTCGGTGTATTTCAGAGGGAGAGGATGCCACATGTCAGTGTTTGAAAGGATTTGCTGGGG
ATGGAAAACTATGTTCTGATATAGATGAATGTGAGATGGGTGTCCCAGTGTGCCCCCCTGCCTCCTCCAA
GTGCATCAACACCGAAGGTGGTTATGTCTGCCGGTGCTCAGAAGGCTACCAAGGAGATGGGATTCACTGT
CTTGATATTGATGAGTGCCAACTGGGGGTGCACAGCTGTGGAGAGAATGCCAGCTGCACAAATACAGAGG
GAGGCTATACCTGCATGTGTGCTGGACGCCTGTCTGAACCAGGACTGATTTGCCCTGACTCTACTCCACC
CCCTCACCTCAGGGAAGATGACCACCACTATTCCGTAAGAAATAGTGACTCTGAATGTCCCCTGTCCCAC
GATGGGTACTGCCTCCATGATGGTGTGTGCATGTATATTGAAGCATTGGACAAGTATGCATGCAACTGTG
TTGTTGGCTACATCGGGGAGCGATGTCAGTACCGAGACCTGAAGTGGTGGGAACTGCGCCACGCTGGCCA
CGGGCAGCAGCAGAAGGTCATCGTGGTGGCTGTCTGCGTGGTGGTGCTTGTCATGCTGCTCCTCCTGAGC
CTGTGGGGGGCCCACTACTACAGGACTCAGAAGCTGCTATCGAAAAACCCAAAGAATCCTTATGAGGAGT
CGAGCAGAGATGTGAGGAGTCGCAGGCCTGCTGACACTGAGGATGGGATGTCCTCTTGCCCTCAACCTTG
GTTTGTGGTTATAAAAGAACACCAAGACCTCAAGAATGGGGGTCAACCAGTGGCTGGTGAGGATGGCCAG
GCAGCAGATGGGTCAATGCAACCAACTTCATGGAGGCAGGAGCCCCAGTTATGTGGAATGGGCACAGAGC
AAGGCTGCTGGATTCCAGTATCCAGTGATAAGGGCTCCTGTCCCCAGGTAATGGAGCGAAGCTTTCATAT
GCCCTCCTATGGGACACAGACCCTTGAAGGGGGTGTCGAGAAGCCCCATTCTCTCCTATCAGCTAACCCA
TTATGGCAACAAAGGGCCCTGGACCCACCACACCAAATGGAGCTGACTCAG


ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT
ACAAGGATGACGACGATAAG
GTTTAA
>RC210817 representing NM_001963
Red=Cloning site Green=Tags(s)

MLLTLIILLPVVSKFSFVSLSAPQHWSCPEGTLAGNGNSTCVGPAPFLIFSHGNSIFRIDTEGTNYEQLV
VDAGVSVIMDFHYNEKRIYWVDLERQLLQRVFLNGSRQERVCNIEKNVSGMAINWINEEVIWSNQQEGII
TVTDMKGNNSHILLSALKYPANVAVDPVERFIFWSSEVAGSLYRADLDGVGVKALLETSEKITAVSLDVL
DKRLFWIQYNREGSNSLICSCDYDGGSVHISKHPTQHNLFAMSLFGDRIFYSTWKMKTIWIANKHTGKDM
VRINLHSSFVPLGELKVVHPLAQPKAEDDTWEPEQKLCKLRKGNCSSTVCGQDLQSHLCMCAEGYALSRD
RKYCEDVNECAFWNHGCTLGCKNTPGSYYCTCPVGFVLLPDGKRCHQLVSCPRNVSECSHDCVLTSEGPL
CFCPEGSVLERDGKTCSGCSSPDNGGCSQLCVPLSPVSWECDCFPGYDLQLDEKSCAASGPQPFLLFANS
QDIRHMHFDGTDYGTLLSQQMGMVYALDHDPVENKIYFAHTALKWIERANMDGSQRERLIEEGVDVPEGL
AVDWIGRRFYWTDRGKSLIGRSDLNGKRSKIITKENISQPRGIAVHPMAKRLFWTDTGINPRIESSSLQG
LGRLVIASSDLIWPSGITIDFLTDKLYWCDAKQSVIEMANLDGSKRRRLTQNDVGHPFAVAVFEDYVWFS
DWAMPSVIRVNKRTGKDRVRLQGSMLKPSSLVVVHPLAKPGADPCLYQNGGCEHICKKRLGTAWCSCREG
FMKASDGKTCLALDGHQLLAGGEVDLKNQVTPLDILSKTRVSEDNITESQHMLVAEIMVSDQDDCAPVGC
SMYARCISEGEDATCQCLKGFAGDGKLCSDIDECEMGVPVCPPASSKCINTEGGYVCRCSEGYQGDGIHC
LDIDECQLGVHSCGENASCTNTEGGYTCMCAGRLSEPGLICPDSTPPPHLREDDHHYSVRNSDSECPLSH
DGYCLHDGVCMYIEALDKYACNCVVGYIGERCQYRDLKWWELRHAGHGQQQKVIVVAVCVVVLVMLLLLS
LWGAHYYRTQKLLSKNPKNPYEESSRDVRSRRPADTEDGMSSCPQPWFVVIKEHQDLKNGGQPVAGEDGQ
AADGSMQPTSWRQEPQLCGMGTEQGCWIPVSSDKGSCPQVMERSFHMPSYGTQTLEGGVEKPHSLLSANP
LWQQRALDPPHQMELTQ

myc-FLAG tag
Chromatograms CHROMATOGRAMS
Sequencher program is needed, download here.
Restriction Sites SgfI-MluI      Cloning Scheme for this gene      Plasmid Map     
Tag Myc-DDK
ACCN NM_001963
ORF Size 3621 bp
OTI Disclaimer The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Product Components The ORF clone is ion-exchange column purified, transfection-ready dried plasmid DNA, and shipped with 2 vector sequencing primers.
Reference Data
RefSeq NM_001963.1, NM_001963.2, NM_001963.3, NM_001963.4, NM_001963.5, NP_001954
RefSeq Size 4877
RefSeq ORF 3624
Locus ID 1950
Cytogenetics 4q25
Domains ldl_recept_b, EGF_CA, EGF, EGF
Protein Families ES Cell Differentiation/IPS, Transmembrane, Adult stem cells, Embryonic stem cells, Induced pluripotent stem cells, Druggable Genome
Protein Pathways MAPK signaling pathway, ErbB signaling pathway, Cytokine-cytokine receptor interaction, Endocytosis, Focal adhesion, Gap junction, Regulation of actin cytoskeleton, Pathways in cancer, Pancreatic cancer, Endometrial cancer, Glioma, Prostate cancer, Melanoma, Bladder cancer, Non-small cell lung cancer
MW 133.95 kDa
Gene Summary This gene encodes a member of the epidermal growth factor superfamily. The encoded preproprotein is proteolytically processed to generate the 53-amino acid epidermal growth factor peptide. This protein acts a potent mitogenic factor that plays an important role in the growth, proliferation and differentiation of numerous cell types. This protein acts by binding with high affinity to the cell surface receptor, epidermal growth factor receptor. Defects in this gene are the cause of hypomagnesemia type 4. Dysregulation of this gene has been associated with the growth and progression of certain cancers. Alternative splicing results in multiple transcript variants, at least one of which encodes a preproprotein that is proteolytically processed. [provided by RefSeq, Jan 2016].
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Citations (1)