LECT2 (NM_002302) Human Tagged ORF Clone

CAT#: RC210790

Reviews ()
Write a review
  • TrueORF®

LECT2 (Myc-DDK-tagged)-Human leukocyte cell-derived chemotaxin 2 (LECT2)



  "NM_002302" in other vectors (6)

Get anti-DDK tag antibody at $68 with code “DDK”. View details.

USD 98.00

USD 390.00


Availability*
In Stock

Size
    • 10 ug


Product images

Specifications

Product Data
Product Name LECT2 (NM_002302) Human Tagged ORF Clone
Type Human Tagged ORF Clone
Tag Myc-DDK
Symbol LECT2
Synonyms chm-II; chm2
Vector pCMV6-Entry
E. coli Selection Kanamycin (25 ug/mL)
Cell Selection Neomycin
Sequence Data
>RC210790 ORF sequence
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGTTTTCCACCAAAGCCCTCCTTTTGGCTGGTCTGATTTCTACCGCACTGGCAGGGCCATGGGCTAATA
TATGTGCTGGCAAGTCTTCCAATGAGATCCGGACGTGTGACCGCCATGGCTGTGGACAGTACTCTGCTCA
AAGAAGTCAGAGGCCTCACCAGGGTGTGGACGTCTTGTGCTCTGCTGGATCTACTGTGTACGCACCATTC
ACTGGAATGATTGTGGGCCAGGAGAAACCTTATCAAAACAAGAATGCTATCAATAATGGTGTTCGAATAT
CTGGAAGAGGTTTTTGTGTCAAAATGTTCTACATTAAGCCAATTAAGTATAAAGGTCCTATTAAGAAGGG
AGAAAAACTTGGAACTCTATTGCCCTTGCAGAAAGTTTATCCTGGCATACAATCGCATGTGCACATTGAA
AACTGTGACTCGAGTGACCCTACTGCATACCTG


ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT
ACAAGGATGACGACGATAAG
GTTTAA
>RC210790 protein sequence
Red=Cloning site Green=Tags(s)

MFSTKALLLAGLISTALAGPWANICAGKSSNEIRTCDRHGCGQYSAQRSQRPHQGVDVLCSAGSTVYAPF
TGMIVGQEKPYQNKNAINNGVRISGRGFCVKMFYIKPIKYKGPIKKGEKLGTLLPLQKVYPGIQSHVHIE
NCDSSDPTAYL

myc-FLAG tag
Chromatograms CHROMATOGRAMS
Sequencher program is needed, download here.
Restriction Sites SgfI-MluI      Cloning Scheme for this gene      Plasmid Map     
ACCN NM_002302
ORF Size 453 bp
OTI Disclaimer The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Product Components The ORF clone is ion-exchange column purified, transfection-ready dried plasmid DNA, and shipped with 2 vector sequencing primers.
Reconstitution 1. Centrifuge at 5,000xg for 5min.
2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA.
3. Close the tube and incubate for 10 minutes at room temperature.
4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom.
5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C.
Reference Data
RefSeq NM_002302.1
RefSeq Size 1077 bp
RefSeq ORF 456 bp
Locus ID 3950
Cytogenetics 5q31.1
Protein Families Druggable Genome, Secreted Protein
MW 16.4 kDa
Gene Summary This gene encodes a secreted, 16 kDa protein that acts as a chemotactic factor to neutrophils and stimulates the growth of chondrocytes and osteoblasts. This protein has high sequence similarity to the chondromodulin repeat regions of the chicken myb-induced myeloid 1 protein. A polymorphism in this gene may be associated with rheumatoid arthritis. [provided by RefSeq, Jul 2008]

Other Versions

Other products for "LECT2"
Frequently bought together (3)
pCMV6-Entry, mammalian vector with C-terminal Myc- DDK Tag, 10ug
    • 10 ug

USD 570.00


LECT2 mouse monoclonal antibody, clone OTI2A11 (formerly 2A11)
    • 100 ul

USD 405.00


Clone OTI4C5, Anti-DDK (FLAG) monoclonal antibody
    • 30 ul

USD 150.00

Customer Reviews 
Loading...
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.
Molbio tools